KEGG   Gardnerella vaginalis HMP9231: HMPREF9231_1307Help
Entry
HMPREF9231_1307   CDS       T01939                                 

Definition
(GenBank) alpha amylase, catalytic domain protein
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
gvh  Gardnerella vaginalis HMP9231
Pathway
gvh00500  Starch and sucrose metabolism
gvh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gvh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF9231_1307
Enzymes [BR:gvh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     HMPREF9231_1307
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     HMPREF9231_1307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF4434
Motif
Other DBs
NCBI-ProteinID: AEF31512
LinkDB All DBs
Position
complement(1599833..1601542)
Genome map
AA seq 569 aa AA seqDB search
MQNEHAQWLRDAVFYEIYPQSFYDSNGDGIGDIPGIIEKLDYVKSLGCNAIWLNPCYDSP
FKDAGYDVRDYKKVAARYGTNEDLQRLFSEAHNRGMHILLDLVPGHTSEEHEWFKQSSRA
QENEFSKRYIWTDSAFSGYSMPFIGGESERDATYILNFFKCQPALNYGFAHRDRAWQSAP
DSEEAAQTRAAMVDVMRFWLALGADGFRVDMADSLVKNDDNNGEGSLGKDNTIRAWQEML
GAVKAEYPQAAFVSEWGRPRQALAAGFDMDFYLNWRWDGQPNGYARLARDVDNALDGNPE
RDHSYFNARGGGSICPFLDDYCPQYEATCNEGYFSFITCNHDTPRLAPRLSERERRIAFG
MILTMPGVPFVYYGDEIGMKYRDIPTKEGGYARTGTRTPMQWDDSKNFGFSTAAKSKLYL
PVEARADGRTCANSRKQAVQSGEIPTVLGQEQDGDSLLNWVRALIALRHECAALHADATW
RVLHAPVDGRSFAYERCAAESNVSDGESSTDRCIVVMNPGLNEETIALSALAGLTPEEIL
QPRISVGAVACDSSALKLGAQSFAAFRLA
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacgaacatgcacaatggctgcgcgacgccgtgttctacgaaatctatccacaa
agcttctacgattcaaacggcgacggaatcggcgatattccaggcataatcgaaaaactc
gactacgtaaaatcgcttggatgcaatgcgatctggctaaatccttgctacgattcgcca
tttaaagacgcgggttacgatgtgcgcgactacaaaaaagtggcagcgcgctacggcaca
aacgaggatttgcaacgtctttttagcgaagcacacaatcgcggaatgcacattctgcta
gacctggttccaggtcacacaagcgaagagcacgagtggtttaagcaaagctcgcgcgcg
caagaaaacgagtttagcaagcgatatatatggaccgacagcgcgtttagcggctattcc
atgccgtttattggcggtgaaagcgagcgagatgccacgtatattctgaacttctttaaa
tgccagccagcgctaaattacggctttgcgcatagggatcgcgcgtggcaatccgcgcca
gattctgaggaggctgcgcaaacgcgtgctgcaatggttgatgttatgcgattctggctt
gcgcttggcgcggatggattccgcgtagacatggcggattcgcttgtaaaaaacgacgac
aacaatggcgaggggagccttggcaaagacaacacgattcgcgcatggcaagaaatgctt
ggcgctgtaaaggccgagtatccgcaggctgcgttcgtttcggagtggggcaggccgcgt
caggcgctggctgctggatttgacatggacttctacttgaattggcgctgggatgggcag
ccaaacggatatgcgcgcctagctagagatgtggataatgcgctagacggcaatcctgag
cgcgaccacagctactttaatgcgcgcggtggcggcagtatttgcccatttttagacgat
tattgcccgcagtatgaggccacttgcaatgagggctactttagctttataacgtgcaat
cacgatacgccgcgcctggctccgcgattaagcgaacgcgaaaggcggattgcgtttggc
atgattcttacaatgccaggcgtgccgtttgtatattacggcgacgaaatcggcatgaaa
taccgcgatattccaacaaaagaaggcggttatgcgcgcacgggcacgcgtacgccaatg
caatgggatgattctaagaattttggattctccacggccgcaaagtcgaagttgtacctg
cctgttgaggcgcgcgcagatggaagaacttgcgcaaactcgcgcaagcaggccgtgcaa
agtggcgaaattccaacggttttgggtcaggagcaggatggcgattcgctgcttaactgg
gtgcgcgcgctgattgctttgcgtcatgagtgcgcggcattgcacgcggatgccacttgg
cgagtgttgcacgctcctgtggatggtcgcagttttgcgtacgagcgatgtgcggctgag
tcgaatgtgtcggatggcgaatcctctacagatagatgcattgtggttatgaatcctgga
ttaaacgaggagacgattgcgcttagcgcgcttgcagggcttacgccagaggagattttg
cagccgcggatttcggttggagcggttgcttgcgattcttccgcgcttaaactcggcgcg
cagtccttcgctgcgttccgacttgcatga

DBGET integrated database retrieval system