KEGG   Gloeobacter violaceus: gll1948Help
Entry
gll1948           CDS       T00148                                 

Definition
(RefSeq) acyl-CoA synthetase
Organism
gvi  Gloeobacter violaceus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Methyltransf_12 AMP-binding_C_2
Motif
Other DBs
NCBI-GeneID: 2600350
NCBI-ProteinID: NP_924894
CYORF: gll1948
UniProt: Q7NJ84
LinkDB All DBs
Position
complement(2073530..2075320)
Genome map
AA seq 596 aa AA seqDB search
MTKSSGKPQMATATRTADNLVEALRRWASVRSARNAYTWEGESAGAVRLTFFEIDRLARA
IAARLQQSNLRGRRAVLLYPPGLEFVAAFMGCLYAGVTAVPAHSPRPRRPAPKLQAILAD
AGVTAVLTTAASLARSDQWTTQNPQLAGLQWLATDNLGTDLADTWQECTFSKDSLAFLQY
TSGSTGHPKGVMITHGNLLHNQRMVEGAFGHSDETIFAGWLPLFHDMGLIGNVLQPLHLG
IPCVLMSPVDFVQKPRRWLEAITRHRATTSGGPNFAYDLCVRKVSAEQREGLDLSSWRVA
FNGAEPVRAHTLQAFAAAFAGCGFRAKAFYPCYGLAEATLFVTGGLFQTPAVVRSVAAAA
LEQDRVVPAAEDDPGSRLLVGCGRPWLGQEVVIADPTNLTLCPPAQVGEIWVAGPSVARG
YWNRPAETAATFGARLAGTGAGPFLRTGDLGFIEGGELFVTGRLKDLIIIRGANHYPQDI
EASVENCHRALRPGCGAAFAVEFDGEERLVVVQELERQLPQALDFEEVLSSIRQAVAARH
GLHVDTAALIKTGSIPKTSSGKIQRRTCRSQFLDGTLPVLYAGGRSPMPPAGRPSV
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaagctcaggaaaaccacagatggcgacagcaacccggacggccgacaacctg
gtcgaggccctcaggcggtgggcttccgtgcgctccgcccggaacgcttacacctgggaa
ggggagagcgccggagctgtgcgactgacgttctttgaaatcgatcgcctggccagggcg
atcgccgccaggctgcagcagtcgaacttgcgcggacgacgggcggtgctgctctatccg
ccggggctggaatttgtggcggcctttatggggtgcctgtacgccggtgtaacggcagtt
ccggcccactccccgcggccgcgccgcccggcgccgaagctccaggccatcctggcggac
gctggggtgacggcggtgctgacgaccgcagcttccctggcccgcagcgatcagtggacc
acccagaatccccaactggccgggttgcaatggctggccaccgacaacctcggcaccgat
ctggccgacacctggcaggagtgcactttctccaaggacagcctcgcgtttttgcagtac
acctccggatcgacaggccatccgaagggggtaatgatcacccacggcaacttgctgcac
aaccagcggatggtcgaaggcgccttcgggcacagcgacgagacgatcttcgcgggctgg
ctgccgctctttcacgacatgggactaatcggcaacgtgctgcagccgctccacctgggt
atcccctgtgtcttgatgtcaccggtggattttgtgcagaagccgcgccgctggctcgaa
gcgatcacccgccaccgcgccaccaccagcggcgggccgaactttgcctacgacctgtgc
gtgcgcaaggtgtcggctgagcagcgcgaggggctcgatctgagcagttggcgcgtggcc
ttcaacggagcggagccggtgcgcgcccacaccctccaggcgtttgctgccgccttcgcc
gggtgtggatttcgggcgaaggcgttctatccttgctacggcctggcggaggccaccctg
tttgtgacaggtggtctttttcagacccccgccgtcgtgcgcagcgtcgccgccgccgcc
cttgagcaagacagggtcgtgcccgccgccgaggacgatcccggcagccgcctgctggtg
ggttgcggacgaccctggttggggcaggaggtggtgatcgccgatccgacgaatttgacg
ctctgcccccccgcgcaggtgggtgaaatctgggttgcagggccgagtgtcgcccggggc
tactggaaccggcccgccgaaaccgcagcgactttcggcgcccgtctggccggcacgggt
gccgggccattcctgcgcacgggcgatctcgggtttatcgagggcggggagttgttcgtc
accggccgcctcaaggacttgatcatcattcggggggcgaaccattacccccaggacatc
gaagcatcggtggaaaattgtcaccgggccttgcgcccgggctgtggggcggcttttgcc
gtcgaattcgacggcgaagaacggctggtggtcgtccaggaactcgaacgacagcttccc
caagcgctggatttcgaagaagtgctcagcagtatccgccaggcggtggcggcccgccac
gggctgcacgtcgatacggccgcgctgatcaaaaccggctccatccccaagacctccagc
ggcaaaatccagcgccgcacctgccgtagccagtttctcgacgggacgctgccggtgctc
tacgccgggggcagaagcccgatgccgcctgcggggcgcccgagtgtctga

DBGET integrated database retrieval system