KEGG   Gloeobacter violaceus: gll2569
Entry
gll2569           CDS       T00148                                 

Definition
(RefSeq) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gvi  Gloeobacter violaceus
Pathway
gvi00010  Glycolysis / Gluconeogenesis
gvi00020  Citrate cycle (TCA cycle)
gvi00620  Pyruvate metabolism
gvi01100  Metabolic pathways
gvi01110  Biosynthesis of secondary metabolites
gvi01120  Microbial metabolism in diverse environments
gvi01200  Carbon metabolism
Module
gvi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    gll2569
   00020 Citrate cycle (TCA cycle)
    gll2569
   00620 Pyruvate metabolism
    gll2569
Enzymes [BR:gvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     gll2569
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding MadL
Other DBs
NCBI-GeneID: 2600970
NCBI-ProteinID: NP_925515
CYORF: gll2569
UniProt: Q7NHG8
LinkDB
Position
complement(2719813..2721072)
AA seq 419 aa
MIREVTMPALSSTMTEGKIVTWKKQEGDAVSRSDILLVVESDKADMDVESFDEGILANIL
VSDGGSAPVGSVIALIAETEAEVAEAKKRPPSGTAAAPPATVPTPAPAPSAPAPVAAATT
PVSSGSNGGRIVASPNARRLAEQLGVDLASITGSGPGGRIVGEDVERAAAGAKAPAPAPA
AKPASAPAPLPAAAASGQPVAFSALQQAVNRNMEAALAIPAFRVGYTITTDAFDELHKSV
KSKGVTVTTMLVKAVAITLAKHPLLFAAYTESGLRYHSAVNVAVAVAMEEGGLITPVLRA
ADSKDLYTLAREWKDLVERARLKKLQPEEYTSGNFTLSNLGMFGVDRFDAIVPPGTSAIL
AIGAAKPTVVVTEAGHIAIQKQMQVNLSGDHRVFYGTDGARFLQDLAKLIEQSPQQLTL
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgatacgcgaagtcacgatgcccgccctgtcctcgacgatgaccgagggcaagatcgtc
acctggaagaagcaggagggagatgcggtcagccgcagcgacatcctgctggtcgtcgag
tccgacaaggcggacatggatgtcgagtcttttgacgagggcatcctcgcgaacatcctg
gtaagcgacggcggcagcgccccggtaggctcggtgatcgccctgattgccgagaccgag
gcggaggtggcagaggcaaaaaaacggcccccaagcggcactgccgccgcaccacctgcg
acggttcccaccccggcaccggcgccgagtgctcctgccccggtggcggccgccacaact
ccagtctcctccggcagcaacggcggccggatcgtcgcttctcccaacgcccgccgcctc
gctgaacaactgggggtggatctggcgagcatcacgggcagcggtcccggtggccggatc
gtgggtgaagatgtcgagcgcgctgcggcaggcgccaaggctccggcccccgcccccgcc
gccaaaccggcgtccgcccctgccccgctcccggctgcggcggcgagcggtcagccggtg
gccttcagcgccctgcagcaggcggtcaaccgtaacatggaagcggccctggccatcccg
gcttttcgggtcggttatacgatcacgaccgatgctttcgacgaactgcacaagtcggtc
aaatcgaagggcgtgacggtgaccacgatgctggtgaaggccgtggccattaccctcgcc
aagcacccgctgctgtttgccgcctacaccgaatccggcctccgctaccattcggcggtc
aatgtcgcagtggcggtggcgatggaggagggggggctgatcaccccggtgctgcgcgcc
gccgacagcaaagatctctataccctggcgcgcgagtggaaagatctggtggagcgcgcc
cgcctcaagaagctgcagccggaggagtacacgagcggcaacttcaccctgtcgaatctg
ggcatgttcggggtcgaccgcttcgatgccattgtgccccccggcaccagcgccattctg
gctatcggtgccgccaaaccgacggtggtagttaccgaggcgggccacatcgccattcaa
aaacagatgcaagtcaacttgagcggcgaccaccgggtcttctacggcaccgacggggcg
cgcttcctgcaggatctggccaagctcatcgagcaatcgccgcagcagttgacgctttga

DBGET integrated database retrieval system