KEGG   Gloeobacter violaceus: glr0940Help
Entry
glr0940           CDS       T00148                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
gvi  Gloeobacter violaceus
Pathway
gvi00040  Pentose and glucuronate interconversions
gvi00051  Fructose and mannose metabolism
gvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    glr0940
   00051 Fructose and mannose metabolism
    glr0940
Enzymes [BR:gvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     glr0940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 FAD_binding_3 Glu_dehyd_C Pyr_redox_2 2-Hacid_dh_C AlaDh_PNT_C Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 2599259
NCBI-ProteinID: NP_923886
CYORF: glr0940
UniProt: Q7NM29
LinkDB All DBs
Position
996963..998045
Genome map
AA seq 360 aa AA seqDB search
MDGNKPMDVPQLMHAAVFYGVGDLRYEQVPVPEVAADEVLVQVRACGLCQSDIKKLRYPL
LDPPRIFGHETSGTIVRAGEAVEHWRVGERVVVLHHIPCFHCPYCLNENYSMCRVYKEVT
TTAGFAPAGGGFAEYVKVPGHIVRSGGLMAIPDGVSFEEASFVEPTNCCLKAVKKAQVQP
GQWVLITGAGPIGLMFAMLCRQFGAKPIVTDLLASRVERARALGAEAALDARSADLTARI
HALTGGLGVDVALLAVPSVQAFSQALDATRKGGKILFFAEFAESVQIPLDPNVLYRREID
LMGSYSSSFKVQHLAADLVFGRRIDVQALISDFYPLAELAAAVEQAVHPTPETCKILIRP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtggatggcaacaagcccatggacgttccccagctgatgcacgcggcggttttctacggc
gtaggcgatctgcgctacgaacaggtgccggttcccgaagtcgcggcggacgaggtgctg
gtgcaggtgcgcgcctgcggtctgtgccagtcggacatcaaaaagctgcgctacccgcta
ctcgacccgccgcgcatcttcggccacgagacgagcggcacgatcgtgcgcgccggggaa
gcggtggagcactggcgggtaggcgagcgggtggtggtgctgcaccatattccttgtttt
cactgcccctactgccttaacgagaactactcgatgtgccgggtctacaaagaagtgacc
actaccgccggctttgcacccgccggcggcggcttcgccgagtacgtcaaggtgcccggc
cacatcgtgcgctcgggaggtctgatggcgattcccgacggggtgagcttcgaagaagcg
agcttcgtcgaacccaccaactgctgcttgaaggccgtgaaaaaagcccaggtccagccc
ggccagtgggtgctgatcaccggcgccggtcccatcgggctgatgttcgccatgctctgc
cgccagttcggagcgaaaccgatcgtcaccgacttgctcgcctcgcgcgtcgagcgcgcc
cgcgcgctcggggccgaggctgccctcgatgcgcgctccgccgatctgaccgcccggatc
cacgccctcaccggcggcctcggagtggatgtcgccttgctcgcggtgcccagcgtgcag
gccttttcccaggccctcgatgcgacgcgcaagggcggcaagattctgttttttgccgaa
tttgccgaatcggtgcaaatcccgctcgatccgaacgtgctctaccggcgcgaaatcgac
ttgatgggctcctacagctcctcgttcaaagtccagcacctggcagccgatcttgtcttc
gggcggcgcatcgacgtgcaggcgctcatctcggacttttatccgctcgctgaactggcg
gcggcggtggagcaggccgtgcatccaacccccgagacctgcaaaattcttatccggcct
tga

DBGET integrated database retrieval system