KEGG   Gloeobacter violaceus: glr4372Help
Entry
glr4372           CDS       T00148                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
gvi  Gloeobacter violaceus
Brite
KEGG Orthology (KO) [BR:gvi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    glr4372
Enzymes [BR:gvi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     glr4372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2 DNA_pol3_theta
Motif
Other DBs
NCBI-GeneID: 2602775
NCBI-ProteinID: NP_927318
CYORF: glr4372
UniProt: Q7ND64
LinkDB All DBs
Position
4604666..4605277
Genome map
AA seq 203 aa AA seqDB search
MIDLYTFTTPNGRKVSVMLEEVGLPYTVHVVDISSGDQHREEYLAINPNGKIPAIIDHDT
GLTIFESGAILIYLAEKTGKLLPSEPAARYAALQWLMWQMGGVGPMFGQLNHFKRFADEH
VPYAIDRYFRESIRLYRVLNRQLSRNLYVAGREYTIADVAIFPWVQIHAFQGIILEDFPA
VEVWFERLKARPAVQRGMQVPAP
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctttacacgttcaccactcccaatggccgcaaagtctcggtgatgctggag
gaagtgggcctgccctacaccgtccatgtcgtggacatctccagcggcgaccagcaccgg
gaagagtacctggccatcaacccgaacggcaaaattccggctattatcgaccacgacacg
gggctcacgatcttcgaatccggggccatcttgatctatctggctgaaaagaccggcaaa
ttgctgccgagcgaacccgctgcccgctacgccgctttgcagtggctgatgtggcagatg
ggcggggtgggaccgatgttcggacagctcaaccacttcaagcgcttcgccgacgagcac
gttccctacgccatcgatcgctactttcgcgagagcatccgcctctaccgggtgctcaac
cggcagttgagccgcaatctttacgtagcgggccgcgagtatacgatcgccgatgtagcc
attttcccctgggtgcagatccacgcattccagggcatcatcctcgaagattttcccgcc
gtcgaagtgtggttcgagcggctcaaagcccgacccgccgtgcaacggggtatgcaggtg
cccgcgccgtag

DBGET integrated database retrieval system