KEGG   Gloeobacter violaceus: gvip280Help
Entry
gvip280           CDS       T00148                                 

Gene name
cmpB
Definition
(RefSeq) bicarbonate transport system permease
  KO
K11951  bicarbonate transport system permease protein
Organism
gvi  Gloeobacter violaceus
Pathway
gvi02010  ABC transporters
Module
gvi_M00321  Bicarbonate transport system
Brite
KEGG Orthology (KO) [BR:gvi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    gvip280 (cmpB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gvi02000]
    gvip280 (cmpB)
Transporters [BR:gvi02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Bicarbonate transporter [MD:M00321] [OT]
    gvip280 (cmpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 2600489
NCBI-ProteinID: NP_925033
UniProt: Q7NIU5
LinkDB All DBs
Position
2240369..2241205
Genome map
AA seq 278 aa AA seqDB search
MTTTLEGRRQSPVQQLLAALPDAGSLQKLAAPVVAIGVFLLLWQLLTLSPDATLPGPAKV
VSETWGLIVDPFFRGSGTNQGLFWQIAASLQRVALGFSLAAAVGIVVGILIGANALIYSA
LDPLFQVLRTIPPLAWLPISLAAIQQSEPAAIFVIFITAIWPIIINTAVGVQQIPQDYNN
VARVLQLSRPKYFFKVLLPAALPYIFTGLKIGVGLSWLAIVAAEMLIGGVGIGFFIWDAY
NSAKVSEIVLALVYVGLVGLLLDKLVGFIGKLVAPTER
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgaccctcgaaggccgccgccaatcgccggtccaacaactgcttgccgcattg
cccgatgccgggagcctgcagaaactcgcagcgccggtggtggcgatcggtgtgttcctg
ctgctgtggcagctgttgactttgagtcccgacgccacgctgccgggacctgccaaggtg
gtctccgagacctggggactgatcgtggatccgtttttccggggttccggcaccaaccag
gggctcttctggcagatcgcagccagcctgcagcgggtggccctcggcttcagcctcgcc
gccgcagtcgggatcgtggtcggtatcttgatcggtgccaatgcgctgatctactcggcc
ctcgatccgctcttccaggtgctgcgcaccattccgcccctcgcctggctgcctatctca
cttgcggccatccagcagtccgaacctgcggcgatttttgtgattttcattaccgccatc
tggcccatcatcatcaacacggcggtaggcgtccagcagatcccccaggactacaacaac
gtcgcccgcgtcctgcagctgtcgcgcccgaagtacttcttcaaggtgctgctgccggcg
gccctgccgtatatcttcaccggcctcaagattggcgtcggcctctcgtggctggcgatc
gtggcggcggagatgctgattggcggcgtcggcatcggcttttttatctgggacgcctac
aacagcgccaaggtgagcgagatcgtgctcgccctggtctacgtcgggctggtgggcctg
ttgctcgacaagctggtgggcttcatcggcaagctcgttgctcccaccgagcgctga

DBGET integrated database retrieval system