KEGG   Gloeobacter violaceus: gvip297Help
Entry
gvip297           CDS       T00148                                 

Gene name
rbcS
Definition
(RefSeq) ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
gvi  Gloeobacter violaceus
Pathway
gvi00630  Glyoxylate and dicarboxylate metabolism
gvi00710  Carbon fixation in photosynthetic organisms
gvi01100  Metabolic pathways
gvi01120  Microbial metabolism in diverse environments
gvi01200  Carbon metabolism
Module
gvi_M00165  Reductive pentose phosphate cycle (Calvin cycle)
gvi_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
gvi_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    gvip297 (rbcS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    gvip297 (rbcS)
Enzymes [BR:gvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     gvip297 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small HTH_34
Motif
Other DBs
NCBI-GeneID: 2600559
NCBI-ProteinID: NP_925104
UniProt: Q7NIM5
LinkDB All DBs
Position
2308900..2309220
Genome map
AA seq 106 aa AA seqDB search
MQTLPKKKFYETMSYLPPLTDAEIAKQIQYMLDKGYIPCVEFNETSEPTMVYWTMWKLPL
FSVRSPQEVLSEVNACRSSYPGCFIRVIGFDNIRQCQTMSFIVYKP
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgctgcccaagaagaagttctacgagacgatgtcctatctgccgccgctcacc
gacgcggagatagccaagcaaatccagtacatgctcgacaaaggctatatcccctgcgtc
gaattcaacgagaccagcgagcccacgatggtctactggacgatgtggaaactgccgctg
ttttcggtacgctctccccaggaagtgctcagcgaagtgaacgcctgccgctcgtcctac
cccggctgctttatccgggtgatcggcttcgacaatatccgccagtgccagacgatgagc
ttcatcgtctacaagccctag

DBGET integrated database retrieval system