KEGG   Geobacillus sp. WCH70: GWCH70_0210Help
Entry
GWCH70_0210       CDS       T00915                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
gwc  Geobacillus sp. WCH70
Pathway
gwc00473  D-Alanine metabolism
gwc01100  Metabolic pathways
gwc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gwc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GWCH70_0210
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    GWCH70_0210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gwc01011]
    GWCH70_0210
Enzymes [BR:gwc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     GWCH70_0210
Peptidoglycan biosynthesis and degradation proteins [BR:gwc01011]
 Precursor biosynthesis
  Racemase
   GWCH70_0210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Tospo_nucleocap
Motif
Other DBs
NCBI-ProteinID: ACS23141
UniProt: C5D4D3
LinkDB All DBs
Position
228598..229761
Genome map
AA seq 387 aa AA seqDB search
MSNLFYRDTWAEIDLDAIYYNVSQLKNFLQNDIRIMAVVKANAYGHGDVQVAKTALEAGA
SYLAVAFLDEAIALRKKGVTAPILVLGACRPSDINIAAKHRITLTVFQPEWIEQAANVYS
ETSPVLFHLKMDTGMGRLGVREETETKRVIEQIDRHPYFSLEGAYTHFATADEINTDYFS
FQYDNFLRMLEWLPYKPPIIHCGNSATALRFPDKAFNMVRFGISMYGLSPSPEIKQYLPY
ELKEAFSLHSRLVHVKKLKPGEKVSYGATYTAETEQWVGTVPIGYADGWLRKLQNFHVLV
NGEKAPIIGRICMDQLMVRLPKQMPVGTKVTLIGRQGDEYISVDDVAQYLGTINYEVPCT
ISYRVPRIFFRNKSIMEVRNFVLDGND
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatttgttttaccgcgatacttgggcagaaattgatttagatgccatttactac
aatgtttcacaattaaaaaactttttgcaaaacgacatccgcattatggcggtagtgaag
gcaaacgcatacggccacggtgatgtacaagtggcaaaaacagcgcttgaagcaggtgct
tcttatttagcagtggcgtttttagacgaagcgattgcgctaaggaaaaaaggagttact
gcacctattcttgtgctaggggcttgccggcctagcgatattaatattgccgcaaagcat
cggattacgctcactgtgtttcagccggaatggatagaacaagcggcaaacgtatacagc
gaaacgagtcccgttttatttcatttaaaaatggatacaggaatgggacggttaggtgtc
agggaggaaacggaaacaaagcgcgtcattgaacaaattgaccgacatccgtatttttca
ttggaaggagcatatactcattttgctacagctgatgaaataaacacggactatttttct
ttccaatacgataattttttgcgaatgcttgaatggcttccatataaaccaccgattatc
cactgcggaaacagtgcgacagctttacggtttccggataaagcctttaatatggtgcgc
tttggcatttcaatgtatggtctatctccttcaccggaaatcaaacaatatttgccgtat
gagctaaaagaagctttttcattgcatagccgtctcgttcatgtgaaaaagttaaagcct
ggagaaaaggtgagttatggagcgacatatacggcggaaacggagcagtgggttggaacg
gtcccgattggatatgcagatggttggttgcgtaaactgcaaaatttccatgtacttgtg
aacggagaaaaagcgccgattatcggaagaatttgcatggatcaattaatggtccgtctg
ccgaagcaaatgcctgttggaacgaaagtgacgctgattgggcggcaaggcgacgaatat
atttctgttgatgacgtggctcaatatcttggaacgattaactatgaggttccttgtaca
ataagttatcgcgttccccgtatttttttcagaaataagagtataatggaagtgagaaat
tttgttttggatggcaatgattaa

DBGET integrated database retrieval system