KEGG   Geobacillus sp. WCH70: GWCH70_0448Help
Entry
GWCH70_0448       CDS       T00915                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
gwc  Geobacillus sp. WCH70
Brite
KEGG Orthology (KO) [BR:gwc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GWCH70_0448
Enzymes [BR:gwc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GWCH70_0448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored DAO AlaDh_PNT_C FAD_binding_3 NAD_binding_7 Thi4 Glutaredoxin Thioredoxin_4 NAD_binding_8 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: ACS23362
UniProt: C5D5D6
LinkDB All DBs
Position
503628..505157
Genome map
AA seq 509 aa AA seqDB search
MILDAEIKAQLAQYLQLMENDIVLKVSAGDDQVSRDMLALVDELAAMSPKIKVEKTQLQR
TPSFSVNRIGEDTGITFAGVPLGHEFTSLVLALLQVSGRPPKVDQNVIDQIKSIKGTYHF
ETYVSLTCHNCPEVVQALNLMSVLNTGISHTMIDGAAFKDEAERKGIMAVPTVFLNGELF
GSGRMSLEEILAKMGNTLDASHFAEKEPFDVLVVGGGPAGAAAAIYAARKGVRTGIVAER
FGGQILDTLGIENFISVKYTEGPKLAASLEEHVKQYDIDIMNLQRAKRLEKKDLIEIELE
NGAVLKSKTVIIATGARWRNLGVPGEAEFKNKGVAYCPHCDGPLFEGKHVAVIGGGNSGI
EAAIDLAGIAKHVTVLEFMPELKADAVLQERLYSLPNVTVLKNVQTKEITGTDKVNGITY
IDRATGEEHHIELQGVFVQIGLVPNTDWLDGTIERNRFGEIIVDKHGATNIPGVFAAGDC
TDSAYKQIIISMGSGATAALSAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgatattggatgccgagataaaagcgcaattagcccaatatctacaattgatggaaaat
gacattgttctaaaagtgagcgcgggagacgatcaagtttcccgcgatatgcttgcttta
gtcgatgaattggccgcaatgtcaccaaaaattaaagtagagaaaacgcagttgcaaaga
acgccaagctttagtgttaatcgtatcggcgaagatactggtataacattcgctggtgtt
cctttagggcatgagtttacctccttagtgcttgctctgcttcaagtaagcggaagaccg
ccaaaggttgatcagaacgtgattgaccaaattaaaagcataaaaggcacctatcacttc
gaaacttacgtgagtttgacatgccataattgtcctgaggtggttcaagcgttgaacttg
atgagcgtcctgaacacgggcatttcgcatacgatgatcgatggcgcagcctttaaggac
gaagcggaaagaaaaggaattatggcagttccaacagtattcctaaatggagagctcttt
ggtagcggtcggatgtcgttggaggaaattttggcgaagatggggaatactttggacgca
tcacatttcgctgaaaaagaaccatttgatgtactggttgtcggtggcggaccagccgga
gcagctgcagcgatttatgcggcgcgtaaaggtgttcgtacaggcattgttgcggaacgt
tttggcggtcaaatattggatacattaggcattgaaaactttatcagtgtgaaatatacg
gaaggccctaagcttgcagcaagccttgaagagcatgtcaaacagtacgatattgatatt
atgaatttacagcgtgccaaacgcttggaaaagaaagatcttattgaaatcgaacttgaa
aatggcgccgtgttaaaaagcaagacggttattatcgcaacgggggctcgctggcgcaac
cttggcgtaccaggcgaggcggagtttaagaacaaaggggtcgcatactgcccacattgc
gatggtccgttgtttgaaggaaaacatgttgcggtcattggtggcggcaattccggtatt
gaggcagccattgatcttgcaggcattgcaaagcatgtcaccgttcttgagtttatgccg
gagctgaaagccgatgctgttttacaagagcgcctttatagcctgcctaacgtaacggtt
ttaaagaacgtgcaaacaaaagaaattaccggtacggacaaagtaaatggcatcacttat
atcgaccgggcgaccggagaggaacatcatattgaattgcaaggggtatttgttcagatc
ggcttagtgccaaatacggactggttagatggaacgattgaacgcaatcgcttcggcgaa
attatcgtcgataagcatggcgctacgaacatccctggagtgtttgctgcaggtgactgc
acggatagcgcgtataagcagatcattatttcaatggggtcaggcgctaccgcagcctta
agtgcatttgattaccttattcgaaattaa

DBGET integrated database retrieval system