KEGG   Geobacillus sp. WCH70: GWCH70_2227Help
Entry
GWCH70_2227       CDS       T00915                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gwc  Geobacillus sp. WCH70
Brite
Enzymes [BR:gwc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GWCH70_2227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Spore_coat_CotO DDHD
Motif
Other DBs
NCBI-ProteinID: ACS24936
UniProt: C5D3M1
LinkDB All DBs
Position
complement(2283616..2284662)
Genome map
AA seq 348 aa AA seqDB search
MNEQERIQQYVAEVKEWGKQVEQILLQRGEDGGDCRVDSLLSYIEHHGDAWTEDAIYELQ
RMVDEVYEKALVFQQNGQSAIRQEESGTEERQQTSIGQEENGIEERQQTAVRQEESGTEE
RQQTASEQEEESEAEERQQTYVAAGRHVLPPLPYSYDALEPHISREIMRLHHTKHHQSYV
DGLNKAEKMMKKARETNDYELLKHWEREAAFHGSGHYLHTIFWNNMHPKGGGQPRGELLE
QIKRDFGSFERFKRHFTEAAKSVEGVGWALLVWSPRSHRLEILQTEKHQFMTQWDTIPLL
VIDVWEHAYYLQYKNDRAAYINNWWNVVHWRDVEERFEQARKLRWKPF
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacaagaacgaattcaacaatatgtggcggaagtaaaagaatggggaaaacaa
gtcgagcaaattttgcttcagcggggggaggacggcggcgattgccgcgttgattcattg
ctttcctacatcgaacatcatggcgacgcatggacagaggacgccatttatgaacttcag
cgcatggtggacgaagtatatgaaaaagcgctggtgtttcagcaaaatggacagtcggcc
atcagacaggaggaaagcgggacagaagaaagacaacaaacgtccatcggacaggaggaa
aacgggatagaagaaagacagcaaacggccgtcagacaggaggaaagcgggacagaagaa
agacaacaaacggccagcgaacaggaagaagaaagcgaggcagaagaaagacaacaaaca
tatgtggcagcaggaagacacgtccttccgccgcttccatacagctacgatgcgcttgag
ccgcatatttccagagaaattatgcggctgcatcatacaaagcaccatcaaagctatgtg
gacggcttaaataaagcggaaaaaatgatgaaaaaagcgcgcgaaacaaatgactatgaa
ctgttgaagcattgggagcgggaagcggcgttccacggttctggacattatttgcacacg
attttttggaataatatgcatccaaaaggcggcggccaaccgcgcggtgagttgctagaa
caaataaaacgagattttggaagttttgaaagatttaagcgtcattttaccgaggcggca
aaaagcgtcgaaggagtcggctgggcgctgctcgtttggtcgccgcggtcgcaccgctta
gaaattttacagacggaaaagcatcaattcatgacgcaatgggatacgattccgcttctt
gtgatagacgtttgggagcatgcctattatttacaatataaaaatgaccgtgcagcatat
attaacaactggtggaatgttgttcattggcgcgatgtggaagaacggtttgagcaggca
agaaaattgcgctggaaaccgttttaa

DBGET integrated database retrieval system