KEGG   Geobacillus sp. WCH70: GWCH70_2678Help
Entry
GWCH70_2678       CDS       T00915                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
gwc  Geobacillus sp. WCH70
Pathway
gwc00020  Citrate cycle (TCA cycle)
gwc00480  Glutathione metabolism
gwc01100  Metabolic pathways
gwc01110  Biosynthesis of secondary metabolites
gwc01120  Microbial metabolism in diverse environments
gwc01130  Biosynthesis of antibiotics
gwc01200  Carbon metabolism
gwc01210  2-Oxocarboxylic acid metabolism
gwc01230  Biosynthesis of amino acids
Module
gwc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gwc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:gwc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GWCH70_2678
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GWCH70_2678
Enzymes [BR:gwc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     GWCH70_2678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ACS25371
UniProt: C5D655
LinkDB All DBs
Position
complement(2709578..2710852)
Genome map
AA seq 424 aa AA seqDB search
MVAQGEKITVTNGVLNVPNNPIIPFIEGDGTGPDIWAAASRVLEAAVEKAYKGEKKIVWK
EVLAGEKAYKQTGEWLPQETIDVIREYIIAIKGPLTTPVGGGIRSLNVALRQELDLFVCL
RPVRYFKGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGTPEVKKVIDFLQNEMGVRKI
RFPETSGIGIKPISEQGTKRLVRAAINYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYEL
AEEEFSDKVFTWAQYDRIVETEGKEAANKALAEAEEAGKIIIKDVIADIFLQQILTRPRE
FDVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNP
SSVILSGVMMFEHLGWNEAAKLIVKAMEKTIAAKIVTYDFARLMEGATEVKCSEFADALI
RNME
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggtggcgcaaggtgaaaaaattactgtaacaaatggtgtgttaaatgtaccaaacaat
ccaattattccatttattgaaggggatgggacaggtccagacatttgggctgccgcatct
cgtgtgttggaagcagcagtagaaaaggcgtataaaggggaaaagaaaatcgtttggaaa
gaagttctcgcaggggaaaaagcgtacaaacaaaccggtgagtggcttccacaagaaacc
attgatgttattcgggaatacataatcgcgattaaaggaccgttgacgactccagtcggc
gggggaattcgttcattgaacgtagcgcttcgccaagagttggatttattcgtttgcttg
cgtccggtccgctattttaaaggtgttccttctccggtaaaacgtccagaagatacagat
atggtcattttccgtgaaaacacggaagatatttatgctggaattgagtatgccaaaggg
acaccagaagtgaaaaaagtgattgatttcttgcaaaatgaaatgggcgttcgcaaaatc
cgcttcccagaaacttctggtatcggcattaagccaatttccgaacaaggaacgaaacgg
ttagtgcgcgctgcaatcaactatgcgattgaacacggacgaaaatcggttacgcttgtt
cataaaggaaatattatgaaatttacggaaggcgcgtttaaaaattggggctatgaatta
gcagaagaagaattcagcgacaaagtatttacgtgggcgcaatatgaccgcattgtcgaa
acagaaggaaaagaagcagcgaacaaggcgctggcggaagcagaagaagccggaaaaatt
attatcaaagacgtcattgccgatattttcttacaacaaattttaacgcgtccgcgcgaa
tttgatgtggttgcaacgatgaacttaaacggcgactatatttctgacgcgttagcagca
caagttggcggcattggtatcgctccgggagcaaacattaactacgaaacagggcatgcc
atttttgaagctactcacggaacggctccgaaatatgcaggattggataaagtgaaccca
tcatcggtcattttatctggtgtgatgatgtttgagcatctcggctggaacgaagcggca
aaactcattgtcaaagcaatggaaaaaacgattgctgcaaaaatcgttacatacgatttt
gctcgtctcatggagggcgctacggaagtaaaatgttcagaattcgctgacgcactcatc
cggaatatggaataa

DBGET integrated database retrieval system