KEGG   Geobacillus sp. WCH70: GWCH70_2686Help
Entry
GWCH70_2686       CDS       T00915                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gwc  Geobacillus sp. WCH70
Pathway
gwc00010  Glycolysis / Gluconeogenesis
gwc00030  Pentose phosphate pathway
gwc00051  Fructose and mannose metabolism
gwc00052  Galactose metabolism
gwc00680  Methane metabolism
gwc01100  Metabolic pathways
gwc01110  Biosynthesis of secondary metabolites
gwc01120  Microbial metabolism in diverse environments
gwc01130  Biosynthesis of antibiotics
gwc01200  Carbon metabolism
gwc01230  Biosynthesis of amino acids
gwc03018  RNA degradation
Module
gwc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gwc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GWCH70_2686
   00030 Pentose phosphate pathway
    GWCH70_2686
   00051 Fructose and mannose metabolism
    GWCH70_2686
   00052 Galactose metabolism
    GWCH70_2686
  09102 Energy metabolism
   00680 Methane metabolism
    GWCH70_2686
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    GWCH70_2686
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:gwc01009]
    GWCH70_2686
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:gwc03019]
    GWCH70_2686
Enzymes [BR:gwc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GWCH70_2686
Protein phosphatases and associated proteins [BR:gwc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GWCH70_2686
Messenger RNA biogenesis [BR:gwc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GWCH70_2686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Peripla_BP_1 NAD_kinase PucR
Motif
Other DBs
NCBI-ProteinID: ACS25379
UniProt: C5D663
LinkDB All DBs
Position
complement(2718945..2719904)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGVEVFGIYYGYAGLIAGKIKKLEVGDVGDI
IHRGGTILYTARCPEFKTEEGQLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWS
GLAGGAETILIPEADYDMNDVIARLKRGHERGKKHSIIIVAEGVGSGVEFGKKIQEATGF
ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIVEAL
ANKHTVDQKMYLLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtataggtgtgttaacaagtggcggagattcaccaggtatgaatgcagcgatt
cgcgctgtcgtccgtaaggcgatttatcatggagtagaagtatttggaatttattatggg
tatgctggcttgattgctgggaaaattaaaaaattagaagtaggggatgtcggcgatatt
atccatcgcggaggtacaatactgtatacggcgcgctgtccggaatttaagacagaagaa
gggcagttaaaagggattgaacaattgaaaaaacacgggattgaaggattagtcgtcatc
ggtggagatggttcttatcaaggtgccaaaaaattaacagagcacggatttccttgtgtc
ggggtgccaggaaccattgacaatgacattcctggaacagattttacgattggtttcgat
acggctttaaacacggtgattgacgcgattgacaaaattcgtgatactgctacatcgcat
gaacgaacatatgtgattgaagtaatggggcgtcatgctggggatattgcgttatggtca
gggcttgctggaggtgcagaaacgattttgattccagaagccgattacgatatgaatgat
gttattgcacggttaaagcgtggtcatgaacgaggcaaaaaacatagtattattatcgtt
gctgaaggtgtcggaagcggagtcgagtttggaaagaaaattcaagaagcgacaggattt
gaaacgcgcgtcacagtgttgggacatgttcagcgcggcggttctccaaccgcgtttgac
cgtgtgttagccagccgcttaggtgcacgggcagtagagctattgttagaaggcaaaggc
ggccgctgcgtcggcatccaaaataatcagcttgtcgaccatgatattgtggaagcatta
gcaaacaaacataccgttgaccaaaaaatgtatttgttatcgaaagagctatccatctag

DBGET integrated database retrieval system