KEGG   Geobacillus sp. WCH70: GWCH70_2865Help
Entry
GWCH70_2865       CDS       T00915                                 

Definition
(GenBank) superoxide dismutase copper/zinc binding
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
gwc  Geobacillus sp. WCH70
Brite
Enzymes [BR:gwc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GWCH70_2865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu FlgD_ig
Motif
Other DBs
NCBI-ProteinID: ACS25546
UniProt: C5D707
LinkDB All DBs
Position
complement(2897147..2897665)
Genome map
AA seq 172 aa AA seqDB search
MFQKLGLLLAVFLFAAGCKKENVTNLEVNMINSAGDSIGTIKLSEQAKGVKLKLDLEGLP
PGEHAIHIHEKGVCKKPDFQSAGSHYNPDGKKHGLLHPEGAHAGDLPNIIVKEDGTVNVE
LTAPNVTLKEGQKGSLLTKDGTAIVIHERKDDGMTQPAGDAGGRIACGEIKK
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
gtgtttcaaaagttaggtttgttactggcggtgtttttatttgccgccggttgtaaaaag
gaaaacgtgacgaatttagaagttaatatgattaatagtgccggtgattcgatcggtacg
ataaaactatcagaacaagcgaaaggcgttaaattgaaactggatttggagggacttccg
cctggtgagcacgcgattcacattcatgaaaaaggagtttgcaaaaagccggactttcaa
tcggctggaagccactacaatccagatggaaagaaacatggattgcttcatccagaaggg
gctcatgccggggacttgcctaatattatcgtaaaagaggacggaacggtaaacgtggaa
ttgacagcgccaaatgtgacgctgaaagaaggacagaaaggttcgctgttgacaaaagac
gggacggcgattgtcatccatgaaagaaaagatgatgggatgacacagccggctggagat
gctggtggacgaattgcatgtggtgaaattaaaaaatag

DBGET integrated database retrieval system