KEGG   Geobacillus sp. WCH70: GWCH70_2937Help
Entry
GWCH70_2937       CDS       T00915                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
gwc  Geobacillus sp. WCH70
Pathway
gwc00071  Fatty acid degradation
gwc00362  Benzoate degradation
gwc00650  Butanoate metabolism
gwc01100  Metabolic pathways
gwc01120  Microbial metabolism in diverse environments
gwc01200  Carbon metabolism
gwc01212  Fatty acid metabolism
Module
gwc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gwc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    GWCH70_2937
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GWCH70_2937
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GWCH70_2937
Enzymes [BR:gwc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     GWCH70_2937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 ApbA NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ACS25613
UniProt: C5D7K3
LinkDB All DBs
Position
complement(2960927..2963311)
Genome map
AA seq 794 aa AA seqDB search
MVKRIQRAAVLGSGVMGSGIAAHLANVGIPTLLLDIVPRELTKEEEAKGLTLEHKEVRNR
LVNQALQKLLKQKPAPLMSKSNLALIEVGNFEDDFHRLAEVDWIIEVVVENLEIKKSVFA
RVDEVRKPGTIVSSNTSGISIEAMAEGRSEDFKRHFLGTHFFNPPRYLKLLEIIPTKDTA
QEVVSYMKTFGEEVLGKGVVMAKDTPNFIANRIGTYGLLVTVREMMKGGYSVGEVDSITG
PLIGRPKSATFRTLDVVGLDTFIHVANNVFEKVEGEEKEAFRVPDFMKAMLEKGWLGSKS
GQGFFLKQGKDILELNYETLEYEPRKKLTTPAVEMSKQAKGLANKLKALVYAGDRAGTFL
WNITAPVLLYSAKLLGEIADDIVAIDRAMKWGFGWELGPFEMWDAIGVEQSVRKMQAEGF
EIPSWVTDMLADGFTSFYKSEKGQAFYYDHGEYKPIKENPKVIHIKRLKEQKDVIKKNSG
ASLIDLGDDVALLEFHSPNNAIGTDIVQMINYALEEVERNYKGLVIGNQGKNFCVGANLA
MILMEAQDDNYFEIEIAVRQFQQAMMNIKYSPKPVVVAPFAMTLGGGTEICLPSSRIQAA
AETYMGLVEVGVGLIPGGGGNKELYIKYLNSLPNGVNVDLQQVANKVFETIAMAKVSSSA
AEACEWNFLSKQDGITMNSDHLLHDAKQAVISLYDQGYRPPVRKKVPVVGETGYAAMLLG
AQSMYHSGYISEHDLKIAKKLAYVIAGGKVPYGTEVDEQYLLDLEREAFLSLVGEPKSQA
RMQHMLVKGKPLRN
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaacgcattcaaagggctgctgtgctcggatctggtgtgatgggttcgggaatt
gcggcgcatttagcgaacgtggggataccgacgttgcttcttgatatcgtcccgcgtgag
ctgacgaaggaagaggaagcaaaagggctaacacttgaacataaagaagtgcgcaaccgc
cttgtcaatcaagcgttgcaaaagttattgaaacaaaagccagcgccgcttatgtcaaag
tccaatcttgctcttattgaagtaggaaactttgaagatgattttcatcgtcttgctgaa
gtggactggattattgaagtggtcgtggaaaatttagaaattaagaaaagtgtatttgca
agggtagatgaggtaagaaaaccgggaacgatcgtcagctcaaacacttcgggcatttcc
atcgaagcaatggcagaaggccgttctgaggactttaaaagacattttttaggaacgcat
ttcttcaatccaccgcgctacttaaagctgcttgaaatcatcccgacaaaagatacagcc
caagaagtggtttcatatatgaaaacatttggagaagaggttcttggcaaaggcgttgtg
atggcaaaagatacgccaaacttcattgcgaaccgaatcggcacgtacggacttttagtc
actgtaagagaaatgatgaaaggcggatacagcgttggagaagtagattcgattaccggg
ccgctgattggccgtccgaaaagcgcgacattccgtacgcttgatgtagttggattagac
acatttattcacgttgccaacaatgtatttgaaaaagtagaaggagaagaaaaagaggca
ttccgcgttccggactttatgaaagcaatgctcgaaaaaggctggctcggcagcaaatcg
gggcaaggcttctttttgaagcaaggaaaagatattttagagcttaattatgaaacgttg
gaatatgagccgcgtaaaaaattaacaaccccggcagtagaaatgagcaaacaagcaaaa
gggcttgccaataagttgaaagcgcttgtatatgcgggtgaccgtgcaggaacattcctt
tggaacattactgccccagttcttctctattctgcgaaattgctcggtgaaattgctgat
gacattgtcgctatcgaccgtgcgatgaaatggggatttggctgggagctcggtccgttt
gaaatgtgggacgcaatcggtgttgagcaatctgttcgtaaaatgcaagcagaaggattt
gaaattccttcgtgggtaacggatatgcttgcggatggattcacctctttctataaatcg
gaaaaagggcaagcattctattacgaccacggagaatacaaaccgattaaagaaaacccg
aaagtcattcatattaagcgcttgaaagagcaaaaagacgttattaagaaaaatagcggc
gcaagtttaattgaccttggcgatgatgtagcgttgttagagtttcactcgccaaataac
gcgatcggcacggatattgttcaaatgattaactatgcccttgaagaagtagaacgaaac
tataaggggcttgtcatcggaaaccaagggaaaaacttctgtgtcggcgcaaatcttgcg
atgattttaatggaagcacaagatgacaactattttgaaattgagattgctgttcgccaa
ttccagcaagcgatgatgaatattaagtatagcccgaaaccagtggtcgttgcaccgttt
gcgatgacactcggtggcggaacggaaatttgtttgccatcatcacgcattcaagccgcg
gcggaaacgtatatggggcttgtggaagttggtgtcggcctcattcctggcggcggcgga
aataaagaactttatattaaatatttaaacagtctgccaaacggagttaatgtcgatttg
caacaagtggcgaataaagtgtttgaaacgatcgcaatggcaaaagtatcaagttcagca
gcggaagcgtgcgaatggaacttcttaagtaaacaagatggcattacgatgaatagtgat
catttgcttcatgacgcgaaacaagcggtgatttctctttacgatcaaggttatcgcccg
ccggttcgcaaaaaagtacctgtggttggtgaaacaggttatgcggcaatgctgcttgga
gcgcagtcgatgtatcattctggatacattagtgaacatgatttaaaaatcgcgaaaaaa
cttgcgtatgtcatcgccggcggaaaagttccatacggtacggaagtggatgaacagtat
ttgcttgatttagaacgcgaagcatttttaagcctagttggcgaaccgaaatcgcaagca
agaatgcaacatatgcttgttaaaggaaagccgttgcgcaactag

DBGET integrated database retrieval system