KEGG   Geobacillus sp. WCH70: GWCH70_3326Help
Entry
GWCH70_3326       CDS       T00915                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
gwc  Geobacillus sp. WCH70
Pathway
gwc00240  Pyrimidine metabolism
gwc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gwc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    GWCH70_3326
Enzymes [BR:gwc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     GWCH70_3326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_14 IMPDH
Motif
Other DBs
NCBI-ProteinID: ACS25966
UniProt: C5D9N8
LinkDB All DBs
Position
complement(3349925..3350542)
Genome map
AA seq 205 aa AA seqDB search
MYIMKQSGWLEVICGSMFSGKSEELIRRVRRATFAKQEVKVFKPTIDNRYSDEAVVSHNG
NSLIAIPVSSPKEIFEHISEKTDVIAIDEVQFFSDDIIDVVQTLADRGYRVIVAGLDQDF
RGEPFGPVPTLMAIAESVTKLQAVCTVCGSPASRTQRLINGVPASYYDPVILVGASESYE
PRCRHHHEVPDKPTKNGQTNNHLAR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtatattatgaagcagtccggctggcttgaggtcatttgcggaagcatgttttccgga
aaatcagaagaattgatccgccgcgttcgtcgcgcgacatttgccaaacaagaagtgaaa
gtatttaaaccgactattgataatcgttatagcgacgaagcggttgtgtcgcataacggc
aattcgttgatcgccattcctgtttcctcgccgaaagaaatttttgagcatatttcagaa
aaaacagacgttattgctatcgacgaagtgcagtttttttccgatgacattatcgatgtc
gtgcagacgctggcagaccgcggctatcgcgtcattgtcgcgggattggaccaagatttc
cgtggcgaaccgtttggacctgtaccaacgttaatggcgattgccgaatcagtcacaaaa
ctgcaagcggtatgcacggtatgcggttcccctgcaagccggacgcagcggcttattaat
ggcgttccagcgtcttattatgaccctgttattttagtaggggcaagcgaatcatacgaa
ccgcgctgccgccaccatcatgaagttcccgataagccaacgaaaaatggacaaactaac
aatcatctcgcccgctga

DBGET integrated database retrieval system