KEGG   Komagataeibacter xylinus: H845_1210Help
Entry
H845_1210         CDS       T03044                                 

Definition
(GenBank) L-aspartate oxidase
  KO
K00278  L-aspartate oxidase [EC:1.4.3.16]
Organism
gxl  Komagataeibacter xylinus
Pathway
gxl00250  Alanine, aspartate and glutamate metabolism
gxl00760  Nicotinate and nicotinamide metabolism
gxl01100  Metabolic pathways
Module
gxl_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:gxl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    H845_1210
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    H845_1210
Enzymes [BR:gxl01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.16  L-aspartate oxidase
     H845_1210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AHI25155
UniProt: W5Y8F3
LinkDB All DBs
Position
1320962..1322521
Genome map
AA seq 519 aa AA seqDB search
MTTLPPLGQLAGQPLIIGGGLAGVMTALSTGRPCVLACPGRLDELRPPLAASMLAQGGMA
AAVGADDTPALHAADTLAAGAGLCDATVVDRVTAAGPATVERLTGLGVQWDRQADGGLQL
GLEAAHGRRRIVHAGEDATGATIMRALVARVRQTPRITVVEHAHARDLLIHDGGVVGCVL
VVGGRTVTLSTPAVVLATGGVGGLFADTTNPAGATGSGLAMATRAGAVLGNMEFVQFHPT
ALSAGPEGQRLCLVSEAVRGEGAILIDETGARFTDELATRDSVSRAVWRHMMDGHSVYLD
ARTALGAAFPRHFPAISALCAAHGIDPVTQPIPVRPAAHYHMGGVMVDPMGRTGVTGLWA
AGEVACTGLHGANRLASNSLLEAVVFGTWIGQQLDDSLSLAATLPDVPLFPSEPAPATPS
LNLRRIMSRHAGVIRSGDGLRGGLKKVMPIVNTDAGLVCAAILLAALLRRESRGGHFRSD
YPHAGAMATPSRFSLADLDARLAEMRDTFAPALNEGMPS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccctgccgccgctgggccagcttgccgggcagccgctgatcatcggtggcggg
ctggcgggcgtcatgaccgcgctgtccaccgggcgtccgtgcgtgctggcctgcccgggg
cggctggatgaactgcgccccccccttgccgccagcatgctggcgcagggcggcatggcg
gcggccgtgggggctgacgacacgcccgcgctgcatgcggcggatacgctggcggcgggg
gcgggactatgtgacgccacggtggtcgatcgcgtaacggcggcagggcctgcgacggtt
gaacgcctcaccggcctgggcgtgcagtgggacaggcaggccgatggcggcctgcaactg
gggctggaagcagcccacgggcggcggcgcatcgtgcatgcgggagaggacgcgaccggg
gccaccatcatgcgcgcgctggtcgcccgcgtgcgacagaccccgcgcataacggtggtg
gaacatgcccatgcgcgtgacctgctgatccatgatggcggcgtggtggggtgcgtgctt
gtcgttggcgggcggaccgtcacgctgtccacgccggccgtggtgctggccacgggcggg
gtgggcggcctgtttgccgataccaccaatcccgccggggccacgggcagtggccttgcc
atggccacgcgcgccggtgccgtgctgggcaatatggaattcgtgcagttccatccgacc
gcgctttccgccgggccggaagggcagcgcctgtgcctggtcagcgaggccgtgcggggc
gagggcgccatcctgatcgatgagactggcgcgcgctttaccgatgaactcgcgacccgc
gacagcgtctcccgcgccgtctggcgtcacatgatggatggccacagcgtgtatctggac
gcccgcacggcgttgggggcggccttcccgcggcattttcctgccatatccgcgctgtgc
gcggcccatggcattgatcccgtaacgcagccgatccccgtgcgtccagcggcccattac
catatgggcggcgtcatggtggaccccatggggcgcaccggggtcacgggcctgtgggca
gcgggggaagttgcatgtactggcctgcatggcgccaaccggctggccagcaattccctg
ctggaagccgtggtgttcggcacatggatcgggcagcagctggatgacagcctctcgctg
gctgcaaccctgcccgatgtcccactctttccgtctgaaccggcccccgcgacaccatca
ctgaacctgcggcggatcatgagccgccatgccggggtcatccggtcgggcgacgggctg
cgcggcggcctgaaaaaggtcatgcccatcgtgaataccgatgccgggctggtctgtgcg
gcgatcctgcttgccgccctgctacggcgtgaaagccggggtgggcatttccgcagcgat
tatccccatgccggggccatggccacgccgtcgcgattcagcctggcggaccttgatgcc
cggctggcggaaatgcgtgatacgtttgcaccggccctgaatgaaggaatgccctcatga

DBGET integrated database retrieval system