KEGG   Komagataeibacter xylinus: H845_1343Help
Entry
H845_1343         CDS       T03044                                 

Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
gxl  Komagataeibacter xylinus
Brite
KEGG Orthology (KO) [BR:gxl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    H845_1343
Enzymes [BR:gxl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     H845_1343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 DAO HI0933_like Thi4 FAD_oxidored Glutaredoxin AlaDh_PNT_C FAD_binding_3 FMO-like
Motif
Other DBs
NCBI-ProteinID: AHI25288
UniProt: W5YFF6
LinkDB All DBs
Position
1472849..1474432
Genome map
AA seq 527 aa AA seqDB search
MLQDPIKTQLKGYLAGLAHPIVLEASLDDTPKSREMHELLHEVAALSDKVQVSETGQATR
RPSFVIRRDGAKTGVTFAAIPLGHEFTSFVLAMLQVGGHAPKIPDDVAARIRALPGPYNF
ETYVALSCQNCPDVVQALNAMCVLNPNIHNVTIDGALFPDEVAARNIMSVPQVYLNGELF
ETGRMEIEQILAKLDTDAPRQAAEKLKDIAPFDVLIIGEGPAGASAAVYAARKGLRTGLL
GDRFGGQVMDTAGIENFISIPETDGPKLAAALEAHVRQYDVEIIPGQRAKELFPAPQPGG
LHGVVLENGAVVHSRTVILATGAHWRHLGVPGEEEYRTRGVAYCPHCDGPFYKGKRVAVA
GGGNSGVEAAIDLAGIVAHVTLLQRGSHLKADKVLQDKLHTLSNVTVLTEALTTRIEGNG
RNVTGLTYRGGDGADHHIDLEGVFVQIGLLPNTGWLKGTLKLNDFGEIIVNDHGATSIPG
VFAAGDATTTPYKQIVIAIGEGAKAALSAFDYLIRVPAPAPQKLVTA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaagatcccatcaagacgcagctcaagggttatctggccggccttgcgcacccg
atcgtgctggaggccagcctggatgacacccccaaatcgcgtgagatgcatgaactcctg
catgaggtcgccgccctttcggacaaggtgcaggtgtccgagacagggcaggccacccgt
cggcccagcttcgtcatccgccgtgatggcgcgaaaacgggggtgacgttcgccgccatc
ccgctggggcatgaattcacctccttcgtgctggcgatgctgcaggtcggtggccacgcg
ccaaagatccccgatgacgtggcggcccggatccgtgccctgccgggaccatacaatttc
gaaacctatgtcgccctgtcgtgccagaactgccccgacgtggtgcaggcgctcaatgcg
atgtgcgtgctgaaccccaacatccataacgtcacgatcgacggggcgttgttccccgat
gaggtcgcggcccgcaacatcatgtccgtgccgcaggtttacctcaatggtgaactgttc
gagacagggcgcatggaaatcgagcagatcctggcgaagctggataccgacgctccccgg
caggccgccgaaaagctgaaggatatcgcgccgttcgatgtcctgattatcggggaaggt
cccgccggggcatcggctgcggtctatgccgcgcgcaaggggctgcgcacgggcctgctg
ggcgaccgctttggcgggcaggtcatggataccgcgggcatcgagaatttcatctccatt
cccgaaaccgatggcccgaaactggccgcggcgctggaagcccatgtccggcagtatgat
gtggagatcattcccggccagcgcgccaaggaactgtttcccgcgccgcaacccggtggc
ctgcatggcgtggtgctggaaaatggcgcggtcgtgcattcccgcacggtcatactggcc
accggcgcgcactggcggcaccttggcgtgccgggtgaggaggaataccgcacccggggc
gtcgcctactgcccgcattgcgatggtcccttctacaagggcaagcgcgtggccgtggcg
ggcggtggcaatagcggggtggaagcggccatcgaccttgcgggcatcgtggcccatgtg
acgctgctgcagcgcgggtcgcacctgaaggcggacaaggtattgcaggacaagctgcat
acgctgtccaatgtcacggttttgaccgaggccctgaccacgcggatcgaaggcaatggc
cgtaacgtgacggggctgacctatcgcggcggggatggcgcggaccatcatatcgatctg
gaaggggtgttcgtgcagatcggcctgctgcccaacaccggctggctgaaaggcacgctg
aagctgaatgactttggtgaaatcatcgtcaacgaccatggcgcgacctccatccccggc
gtgttcgcggcaggcgatgcgacgaccacgccctacaagcagatcgtcattgccataggc
gaaggggcaaaggccgcgctgtccgcctttgactacctgatccgcgtgcccgcgcctgcg
ccgcaaaagctggttacggcctga

DBGET integrated database retrieval system