KEGG   Komagataeibacter xylinus: H845_1632Help
Entry
H845_1632         CDS       T03044                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
gxl  Komagataeibacter xylinus
Pathway
gxl00970  Aminoacyl-tRNA biosynthesis
gxl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gxl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    H845_1632
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:gxl03029]
    H845_1632
Enzymes [BR:gxl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     H845_1632
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     H845_1632
Mitochondrial biogenesis [BR:gxl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    H845_1632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AHI25575
UniProt: W5Y9L4
LinkDB All DBs
Position
complement(1775975..1777423)
Genome map
AA seq 482 aa AA seqDB search
MSYTLEGKTGTWEIVVGLEVHAQVISHSKLFSGASASYGGEPNTHVSLIDAGFPGMLPVL
NQECVAQAIRTGLGLRARINLESRFDRKNYFYADLPTGYQISQFTHPIVGEGTVEIELGD
GTVRHIGITRLHMEQDAGKSMHDQDPTRSFIDLNRAGVALMEIVSEPDIRSPEEAGAYLR
KLRQILRYLGTCDGNMEEGSMRADVNVSVRKAGEPFRTRCEIKNVNSIRYVMHAIEVEAT
RQIAVWEDGGEVDQETRLFDPSRNETRSLRSKEDAHDYRYFPDPDLLPLVVEQAWVDELE
RALPELPDDKRDRFIKQYGIPRYDASVLVAEQAIADYYEEVAKGRDARLAANWVTGDLFG
ALNRTGRSIQDSPISAQALGGMLDLMADKTINGKIAKEVFEDMLETGDSAADIVDRKGLK
QVTDTGAIDAAVADVLARNADKVAEYRGGKDRLFGFFVGQVMKAMAGKANPAIVNEALKK
VL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgagctacacactcgaaggcaagaccggcacgtgggaaatcgtggtgggcctggaagtc
cacgcgcaggtgatcagccattccaagctgttttccggtgcctccgcatcctacggtggc
gaacccaacacccatgtcagcctgattgacgcgggttttcccggcatgctgccggtcctg
aaccaggaatgcgtggcgcaggccatccgcaccgggctgggactgcgcgcgcgcatcaac
ctggaaagccggttcgatcgcaagaactatttctatgccgacctgccgaccggttaccag
atcagccagtttacccatcccatcgttggcgaaggcacggtcgagatcgaactgggcgac
ggcacggtgcgccatatcggcataacccgcctgcatatggaacaggatgcgggcaagtcc
atgcatgaccaggacccgacgcggtccttcatcgacctgaaccgcgccggtgtcgcgctt
atggaaatcgtgagcgaacccgacatccgcagcccggaggaagctggcgcctacctgcgc
aagctgcgccagatcctgcgctaccttggcacatgcgatggcaacatggaggaagggtcc
atgcgcgccgacgtgaacgtgtcggtgcgcaaggcgggcgagccgttccgcacgcgctgc
gagatcaagaacgtcaactccatccgctacgtcatgcacgcgatcgaggtcgaggccacg
cgccagatcgcggtatgggaggacggtggcgaggtcgatcaggaaacccgcctgttcgat
ccgtcgcgcaatgagacccgttccctgcgcagcaaggaagacgcgcacgattaccgctac
ttccccgaccccgacctgttgccgctggtggtggagcaggcatgggtggacgaactggaa
cgcgccctgcccgaactgcctgatgacaagcgtgaccgcttcatcaagcagtatggcatc
ccccgctacgacgccagcgtgctggtggccgagcaggccattgccgattattacgaggaa
gtggccaagggccgtgacgcccgccttgccgccaactgggtcacgggcgacctgttcggc
gcgctgaaccgcacgggccgcagcattcaggacagccccatctcggcgcaggcgctgggc
ggcatgctggacctgatggctgacaagaccatcaatggcaagattgccaaggaagtcttt
gaagacatgctggaaaccggcgatagcgccgccgacatcgtggaccgcaagggcctgaag
caggtaaccgataccggcgcgatcgacgccgccgtggccgacgtgctggcacgcaatgcg
gacaaggtggcggaataccggggcggcaaggaccggctgttcggattttttgtagggcag
gtgatgaaagccatggccggcaaggccaatccggccatcgtgaacgaagccctgaaaaaa
gttctgtaa

DBGET integrated database retrieval system