KEGG   Komagataeibacter xylinus: H845_3013Help
Entry
H845_3013         CDS       T03044                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
gxl  Komagataeibacter xylinus
Pathway
gxl00020  Citrate cycle (TCA cycle)
gxl00190  Oxidative phosphorylation
gxl00650  Butanoate metabolism
gxl01100  Metabolic pathways
gxl01110  Biosynthesis of secondary metabolites
gxl01120  Microbial metabolism in diverse environments
gxl01130  Biosynthesis of antibiotics
gxl01200  Carbon metabolism
Module
gxl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gxl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
gxl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:gxl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    H845_3013
   00650 Butanoate metabolism
    H845_3013
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    H845_3013
Enzymes [BR:gxl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     H845_3013
    1.3.5.4  fumarate reductase (quinol)
     H845_3013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4
Motif
Other DBs
NCBI-ProteinID: AHI26919
UniProt: W5YDE6
LinkDB All DBs
Position
3229458..3231269
Genome map
AA seq 603 aa AA seqDB search
MNATTSPLTGSYRIVDHAYDVVVVGAGGSGLRATLGMGAAGLKTACVTKVFPTRSHTVAA
QGGIGASLGNMAEDNWRWHMYDTVKGSDWLGDQDAIEYMCREAVPAVQELEHMGVPFSRT
EDGKIYQRPFGGHMRNYGEAPVPRACAAADRTGHAILHTLYQQCLKHNVEFFVEYFAIDL
IMDDDGACRGVMAWCLEDGTLHRFRAQKVVLATGGYGRAYHSCTSAHTCTGDGGGMAIRA
GIPMQDMEFVQFHPTGIFPAGCLLTEGCRGEGGYLTNSEGERFMERYAPTAKDLASRDVV
SRAMTIEINEGRGCGPEKNYIMLHLEHLGPEILHERLPGISETARIFAGIDVTKEPVPVL
PTVHYNMGGIPTNYHGEVIRPTADDVDAVVPGLMAVGEAACVSVHGANRLGTNSLLDLVV
FGRAAAQRAAATIKSEEVIAPLPAGAGDAAIARFDRLRYAKGKTHVADMRGKLQRTMQKH
AAVFRNTESLAQGVEKIKEIWSEIPDISINDRSLIWNSDLMEALEFENLLANATVTMAGA
DARHESRGAQAHDDYPNRDDKNWMKHTVAHMTDKGDVTLSYRPVHMKTLTNDVQVFPPKK
RVY
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgaccacttcaccactcaccggctcctacaggatcgttgaccacgcatatgac
gtggttgtcgtaggcgctggtggctccggcctccgggccacgctgggcatgggggccgcc
ggcctcaagaccgcctgcgtgaccaaggttttccccacacgcagccataccgtcgcagcc
cagggcggcatcggcgcatcgcttggcaacatggccgaggataactggcgctggcacatg
tacgataccgtcaagggatcggactggctgggcgatcaggacgccatcgaatacatgtgc
cgcgaagccgtgcccgccgtgcaggaactcgagcacatgggcgtgccgttctcccgcacg
gaagacggcaagatctaccagcgccccttcggcggccacatgcgcaactatggcgaggcc
ccggtgccgcgcgcctgcgccgccgccgaccgcacgggccatgccatcctgcacacgctg
taccagcagtgcctgaagcataacgtcgaattcttcgtcgaatacttcgccatcgacctg
atcatggatgacgacggcgcgtgccgtggcgtcatggcatggtgcctggaagacggcacg
ctgcaccgtttccgcgcgcagaaggtcgtgctggcgaccggcggttatggccgcgcctac
cactcatgcacctcggcgcatacctgcacgggcgatggcggtggcatggcgatccgcgcc
ggcatcccgatgcaggacatggaattcgtgcagttccaccccaccggcatcttccccgcg
ggctgcctgctgacggaaggctgccgtggcgaaggcggctacctgaccaattccgaaggc
gagcgcttcatggaacgctacgcccccacggccaaggacctggcatcgcgtgacgtcgtc
tcgcgcgccatgaccatcgagatcaacgaaggtcgcggctgtggtccggaaaagaactac
atcatgctccacctcgagcatcttggccccgagatcctgcatgaacgcctgcccggcatt
tcggaaacggcgcgcatcttcgcaggcatcgacgtgaccaaggagccggtaccagtgctg
ccgacggtgcattacaacatgggcggcatccccaccaactaccatggcgaggtcatccgc
cccacggccgatgatgtcgatgcggtggtgcccggccttatggcggtgggtgaagcggcc
tgcgtgtccgtgcatggcgcgaaccgccttggcaccaactcgctgcttgaccttgtggtg
tttggccgcgccgccgcccagcgcgccgccgccaccatcaagagcgaggaagtgatcgcc
ccgctgcccgcaggtgccggcgatgccgcgatcgcacgtttcgaccgcctgcgctacgcc
aagggcaagacccatgtggccgacatgcgcggcaagctgcagcgcaccatgcaaaagcac
gccgccgtgttccgcaacaccgaaagccttgcgcagggtgtggagaagatcaaggaaatc
tggtcggaaattcccgatatctcgatcaacgaccgttcgctgatctggaacagcgacctt
atggaagcgctggaattcgagaacctgctggccaacgccaccgtcaccatggcaggggcc
gatgcccgtcacgaaagccgcggcgcgcaggcgcatgacgactatcccaaccgtgacgac
aagaactggatgaagcacaccgtcgcccacatgaccgacaagggcgatgtcacgctaagc
taccgccccgtgcacatgaaaacgctgacaaacgatgtgcaggtcttcccccccaagaag
cgcgtctactga

DBGET integrated database retrieval system