KEGG   Komagataeibacter xylinus: H845_3014Help
Entry
H845_3014         CDS       T03044                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
gxl  Komagataeibacter xylinus
Pathway
gxl00020  Citrate cycle (TCA cycle)
gxl00190  Oxidative phosphorylation
gxl00650  Butanoate metabolism
gxl01100  Metabolic pathways
gxl01110  Biosynthesis of secondary metabolites
gxl01120  Microbial metabolism in diverse environments
gxl01130  Biosynthesis of antibiotics
gxl01200  Carbon metabolism
Module
gxl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gxl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
gxl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:gxl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    H845_3014
   00650 Butanoate metabolism
    H845_3014
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    H845_3014
Enzymes [BR:gxl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     H845_3014
    1.3.5.4  fumarate reductase (quinol)
     H845_3014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer2
Motif
Other DBs
NCBI-ProteinID: AHI26920
UniProt: W5YD79
LinkDB All DBs
Position
3231296..3232078
Genome map
AA seq 260 aa AA seqDB search
MVEFRLPKNSTVGKGRIFTAAPGATNVKNFRIYRWSPDDDKNPVVDTYEIDLDKIGPMVL
DALIHIKNDVDSTLTFRRSCREGICGSCAMNIAGENTLACLKPIRDIEGDIAIYPLPHMP
IIKDLVPDLDGAYAQLRSIDPWLKSDTLPPPDSERRQSIEERAQLDGMWECILCFCCSTS
CPSYWWNGDRYLGPATLLAAYRWIADSRDEHAGDRLDALEDPLKLYACRTIMNCTQTCPK
GLNPAKAIGQIKELQLERKA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaattcaggctgccaaagaacagcacggtgggcaagggccgcatcttcactgcc
gcccccggcgccaccaatgtcaagaacttccggatctatcgctggagtccggatgacgac
aagaaccccgtggtcgatacctacgagattgatctggacaagatcgggccgatggtgctc
gacgcgctgatccatatcaagaacgatgtcgactcaaccctgaccttccggcgttcatgc
cgtgaagggatctgcgggtcgtgcgcgatgaacatcgcgggggaaaacacgctggcgtgt
ctcaagcccatccgggacatcgagggcgatatcgcgatctacccgctgccgcacatgccg
atcatcaaggacctggtgcccgaccttgatggtgcgtacgcgcagttgcgctcgatcgat
ccgtggttgaaatccgacacgctgccgccgccggattccgaacgccgccagagcattgag
gaacgcgcccagctggatggcatgtgggaatgcatcctgtgcttctgctgctccacctcg
tgcccgtcctactggtggaatggcgaccgctaccttggcccggcaacgctgctggcggcc
tatcgctggattgccgacagccgtgacgaacatgcgggcgaccgtctggacgcactggaa
gatccgctcaagctgtatgcctgccgcacgatcatgaactgcacccagacctgccccaag
ggcctgaaccccgccaaggcgattggccagatcaaggaactgcaactggaacgcaaggca
tag

DBGET integrated database retrieval system