KEGG   Komagataeibacter xylinus: H845_3060Help
Entry
H845_3060         CDS       T03044                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
gxl  Komagataeibacter xylinus
Pathway
gxl00061  Fatty acid biosynthesis
gxl00620  Pyruvate metabolism
gxl00640  Propanoate metabolism
gxl01100  Metabolic pathways
gxl01110  Biosynthesis of secondary metabolites
gxl01120  Microbial metabolism in diverse environments
gxl01130  Biosynthesis of antibiotics
gxl01200  Carbon metabolism
gxl01212  Fatty acid metabolism
Module
gxl_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:gxl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    H845_3060
   00640 Propanoate metabolism
    H845_3060
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    H845_3060
Enzymes [BR:gxl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     H845_3060
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     H845_3060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp Dala_Dala_lig_C LpxI_N
Motif
Other DBs
NCBI-ProteinID: AHI26966
UniProt: W5YCW8
LinkDB All DBs
Position
3278286..3279638
Genome map
AA seq 450 aa AA seqDB search
MFSKILIANRGEIALRILRACRELGIRTVAVHSTADTDAMYVRLADEAVCIGPPASRDSY
LNVAAILSAATITGADAIHPGYGFLSENADFAETVEAHGITFIGPTADHIRMMGDKITAK
TTMMALGVPLVPGSDGALENLEQAREVAARVGYPVLIKAAAGGGGRGMKVAPTEADLEEA
WSVARTEARAAFGNDEVYLEKYLDKPRHIELQIMADTHGNVVHYGERDCSLQRRHQKLLE
EAGSPALTARQRDEIGAIATSALTKLGYRNAGTLEFLYQDGQFCFIEMNTRLQVEHPVTE
MVCDVDLVREQIRIAAGEPLGYSQSDITFSGHAIECRINAEDPQTFMPTPGTITVYHPPG
GLGVRIDSALYAGYRVPPYYDSMIAKLIVRAPTRLEAIERMRRALDEFVIEGVKTVIPLH
RKILDDPQFRKGDYTIHWLENFVARQQDRN
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgttttccaagatcctcattgccaatcgtggcgagatcgccctgcgcatcctgcgggcc
tgccgcgaactgggtatccggacggttgccgtgcattccacggccgacaccgatgccatg
tatgtccgtctggcggatgaagccgtgtgcatcgggccgcccgccagccgcgactcgtat
ctcaatgtcgcggccatcctgtcggccgccaccattaccggggcggacgcgatccatccc
ggttacggcttcctgtcggaaaacgccgacttcgccgaaacggtggaagcccacggcatc
accttcatcgggccgacggcggaccatatccgcatgatgggcgacaagatcaccgccaag
accaccatgatggcgctgggcgtgccgctggtccccggatcggatggcgcgctggaaaac
cttgagcaggcgcgcgaggtggcggcaagggtcggctatcccgtgctgatcaaggcggcc
gcgggcggcggcggccgtggcatgaaggtcgcccccaccgaggccgaccttgaggaagcg
tggagcgtcgcccgcaccgaagcccgcgccgcctttggcaatgacgaggtgtatctggaa
aaatacctcgacaagccgcgccatatcgaactgcagatcatggccgacacgcatggcaac
gtggtgcattacggcgaacgggactgctcgctgcaacgccgccaccagaagctgctggaa
gaggcgggatcacccgcgctgacggccaggcagcgtgacgaaatcggtgcgatcgccacc
agcgccctgacaaagctgggataccgcaacgccggcacgctggagttcctgtaccaggac
gggcagttctgcttcatcgagatgaacacccgcctgcaggtggaacatccggtgacggaa
atggtgtgcgacgtggacctggtgcgcgagcagatccgcatcgcggcgggggagccgctt
ggctacagccagtcggacatcacgttctcgggccatgcgatcgaatgccgcatcaatgcg
gaagacccgcagaccttcatgcccacgccgggcacgatcaccgtctatcacccgccgggc
ggcctgggggtgcgaatcgacagcgcgctttatgcgggctaccgcgtgccgccctattac
gacagcatgatcgccaagctgatcgtgcgcgcccccacgcggcttgaggccatcgaacgc
atgcgccgcgcgctggacgaattcgtgatcgaaggggtcaagacggtcatcccgctgcac
cgcaagatcctggatgacccccagttccgcaagggtgactacaccatccactggctggaa
aacttcgtggcccgccagcaggacaggaactga

DBGET integrated database retrieval system