KEGG   Komagataeibacter xylinus: H845_3626Help
Entry
H845_3626         CDS       T03044                                 

Definition
(GenBank) hypothetical protein
Organism
gxl  Komagataeibacter xylinus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Herpes_UL25 AIP3 Cdc6_C
Motif
Other DBs
NCBI-ProteinID: AHI27527
UniProt: W5YEA4
LinkDB All DBs
Position
pGX5:complement(227932..229098)
Genome map
AA seq 388 aa AA seqDB search
MTSAATATTSRDPFSADRGIEPVPFRKLGTTPEPDPSPEPDTIAEPLSPHPQPVTAAPDK
NRPVPHAIALFRALPRRRQVMIAGTAVGSLLSLFLVMGIAKRQASPVGQEVGMISAPLPS
GPKASPASRHSPTSSPSSPAPQVSATNEDLKALLAIKKPPHPAGLLPETPSAETTPAQKH
DTGIEKAVTTDDAVQKATRLQAAPMTSDDQLQVLQLVTEEAALVQRTRSDIAALRQDLDR
LRIADTAKASDLNRRMSLLEAKRAVADAEAPPSNGPAATRAAADKARATLEAAAAEPQPA
PTPPQSPASRTAKMHQTPPAPPPTWTPHYRILAASPQLAMVQDDAAPAGQPPQSEIEIGT
DLRGYGRVRAISQRGTMWVIQAERGIIQ
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgacctcagccgcaaccgcaacgacgtcccgggatccgttcagcgcggatcgcggcatt
gaacctgttccgtttcgcaagctgggcacgacgcccgagcctgacccttcgcctgaaccg
gacacaattgccgagcctctctctcctcacccgcaacctgtgacagcagcacctgacaaa
aaccgacccgttccacatgcaatagcccttttcagggcgcttccgcgtcgcaggcaggtc
atgatagcgggtactgccgtcggcagtctgctctccctcttcctcgtgatgggcatagca
aagaggcaggcgtctcccgtgggccaggaagtcggaatgatttccgccccgctaccatca
ggccccaaagcgtctcccgcgtcgaggcactcacctacatcatcgccatcatccccggca
cctcaggtctcggctacaaatgaggatctcaaggcacttcttgcgataaaaaagccgccc
catcccgccggcctactaccggaaactccgtcggccgagacaacacccgcgcagaaacac
gacactggcatcgaaaaggctgttacgacggacgatgcggtccagaaagcaacccgcctg
caagcggctcccatgacatcggacgaccagttgcaggtgctgcagcttgtaacggaagaa
gcagcactggtgcagcggacccgcagcgacatcgcagcactccggcaggatcttgaccgg
ctgcgtatcgcagatacggcaaaggcttcggatctcaaccgccggatgtcgctcctcgaa
gccaaacgagccgtggccgacgccgaagcgcccccgtcaaatggaccggccgccacacgc
gccgcggccgacaaggcacgggcaactctggaagccgcggcggccgagccacagccagca
ccaacgccgccgcaatctccagcgtcccggacagcgaaaatgcaccagacgcctcctgct
ccgcccccaacatggacgccgcactaccggatacttgctgcatctccccagcttgccatg
gtgcaggacgatgcggcgccagccgggcaaccgccacagtccgaaatcgaaatcggcacc
gatctccgcggatatggtcgtgtgcgcgccatctctcaacgcggcacgatgtgggtgatc
caggctgaacgcggcatcatccagtaa

DBGET integrated database retrieval system