KEGG   Komagataeibacter medellinensis: GLX_01620Help
Entry
GLX_01620         CDS       T01631                                 

Definition
(GenBank) thioredoxin reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
gxy  Komagataeibacter medellinensis
Brite
KEGG Orthology (KO) [BR:gxy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GLX_01620
Enzymes [BR:gxy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GLX_01620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA DAO Thioredoxin_3 FAD_oxidored FAD_binding_2 Thi4 HI0933_like AlaDh_PNT_C Glutaredoxin NAD_binding_7 FAD_binding_3 FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: BAK82574
UniProt: G2I2F8
LinkDB All DBs
Position
189085..190665
Genome map
AA seq 526 aa AA seqDB search
MLQDPIKAQLKGYLAGLAHPIVLEASLDDSAQSREMHELLHEVAALSDKVQVSEAGQATR
RPSFVIKREGGRAGVTFAAIPMGHEFTSFVLALLQVGGHPPRLSDDEIAQIKALPGPYHF
ETYVSLSCQNCPDVVQALNAMSVLNPNISNVTIDGALFQDEVTAKNIMSVPQVYLNGAPF
ETGRADMEQLLAKLDADAPRRAAEKLKDIAPFDVLIIGGGPAGASAAIYAARKGLRTGVV
AERFGGQVMDTAGIENFISVPETDGPKLAAALEAHVRAYDVEIISGQRAKELFPAALPGG
LHSVALESGAILHARTVILATGAHWRHLGVPGEEEYRNKGVAYCPHCDGPFYKGKRVAVA
GGGNSGVEAAIDLAGIVAHVTLLQRGSYLKADKVLQDKLHSLPNVTVLTEALTTRIEGNG
RNVTGLTYRGGDGADHHVDLEGVFVQIGLLPNTDWLKTTLRLNDFGEIVVNDHRATSVPG
VFAAGDATTTPYKQIVIAIGDGATAALSAFDYLIRVPAPASRSVPA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaagatcccatcaaagcgcagctcaaggggtatctggcaggtctcgcgcacccc
atcgtgcttgaggcatcgctggatgacagcgcgcaatcgcgcgagatgcatgaactcctg
cacgaggtcgccgccctttccgacaaggtgcaggtatcagaggcggggcaggccacgcgc
cggccctcctttgtcataaagcgcgaagggggcagggcaggggttacgtttgccgccatc
cccatggggcacgagttcacatctttcgtgctggcgctgctgcaggtgggcggacacccg
cccaggctgtctgatgatgaaatcgcacagataaaagcgctgccggggccataccatttc
gagacctatgtctcgctgtcatgccagaactgccctgatgtggtgcaggcgctcaatgcc
atgagcgtgctcaaccccaatatcagcaatgtcacgattgacggggcattgtttcaagat
gaggtcacggcaaagaacatcatgtccgtgccgcaggtctaccttaatggcgcgccgttc
gagaccgggcgcgccgatatggagcagcttctggcaaagctggatgctgatgctccccgc
cgtgctgcggaaaagttgaaggacattgctccgtttgacgtgctgatcattggcggtggc
cccgctggggcatcggctgcaatctacgccgcgcgcaagggcctgcgaacgggtgtggtg
gccgagcgctttggcgggcaggtcatggataccgccgggatcgagaactttatctccgtg
cccgaaaccgacggaccaaagcttgcagcggcactggaggcgcatgtgcgtgcctatgat
gtcgagatcatcagcggccagcgcgccaaggaactttttccggcggccctgccgggtggc
ctccatagtgttgcgctggaaagcggggcgatcctgcatgctcgcaccgtcatactggct
actggtgcccactggcggcacctgggtgtaccgggtgaggaggaataccgtaacaagggt
gttgcctattgcccgcattgtgatggtcccttttataagggtaagcgcgtggccgtggcg
ggtggtggcaatagtggggtggaagctgcgatcgacctggccggcattgttgcgcatgtc
acgctgctgcagcgcgggtcgtacctgaaggccgacaaggtgctgcaggacaagttgcac
agcctgcccaacgtgacggtgctgaccgaggcactgaccacccggatcgaaggcaacggc
aggaacgtgaccggcctgacctatcgtggcggcgacggggccgaccaccatgtcgatctg
gaaggcgtgtttgtgcaaatcggtctgctgcctaataccgactggctgaagaccacgctc
agactcaacgattttggggagattgtagtcaacgaccatcgcgcgacgtccgtgccgggc
gtgttcgccgcaggcgatgccacgacaacgccctacaagcagatcgtcatcgccattggt
gatggggccacagcagccctctcggcctttgattacctgatccgcgtgccagccccggcc
tcccggtccgtgccggcctga

DBGET integrated database retrieval system