KEGG   Geobacillus sp. Y412MC52: GYMC52_0213Help
Entry
GYMC52_0213       CDS       T01399                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00473  D-Alanine metabolism
gya01100  Metabolic pathways
gya01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gya00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GYMC52_0213
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    GYMC52_0213
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gya01011]
    GYMC52_0213
Enzymes [BR:gya01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     GYMC52_0213
Peptidoglycan biosynthesis and degradation proteins [BR:gya01011]
 Precursor biosynthesis
  Racemase
   GYMC52_0213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADU92725
UniProt: A0A0E0T7R2
LinkDB All DBs
Position
234931..236085
Genome map
AA seq 384 aa AA seqDB search
MDEFHRDTWVEIDLDAIYDNVANLRRFLPGGTQIMAVVKANAYGHGDAQVAATALEAGAS
RLAVAFLDEALALRKKGIDAPILVLGASRPEDVALAAEHRIALTVFRSDWLEKASSLYNG
STPIHFHLKMDTGMGRLGVKDEEETKRIAALIDRHPPFVLEGVYTHFATADEVNTDYFSY
QYARFLHMLDWLPSRPPLVHCANSAAALRFSDRAFNMVRFGISMYGLAPSPDIKPLLPYE
LKEAFSLHSRLVHVKKLQPGEKVSYGATYTAQTEEWIGTIPIGYADGWLRRLQHFHVLVG
GQRAPIVGRICMDQCMIRLPEPLPVGTKVTLIGRQGDEVISIDDVARHLGTINYEVPCTI
SYRVPRIFFRNKRIMEVRNAVGRG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggacgagtttcaccgcgatacgtgggtggaaattgatttggacgccatttacgacaac
gtcgcgaatttgcgccgctttttgccggggggtacgcaaattatggccgttgtcaaggcg
aacgcctacgggcacggcgatgcccaagtggcggcaacggcgctcgaagcgggcgcttcc
cgcttggccgtcgcctttttggacgaggcgcttgccttacgaaaaaaaggcatcgatgcc
ccgattttagtgcttggggcgtctcgtcccgaggatgtggcgttggccgccgaacaccgc
atcgccttaaccgtgtttcgctctgattggctcgagaaggcgtcatcgctgtataacggt
tcgaccccgattcatttccatttaaagatggacacgggaatgggacggcttggggtgaaa
gacgaagaggagacaaagcgaatagcggccttgatcgatcgccatccgccctttgtgctt
gaaggggtgtatacgcattttgcgaccgctgatgaagtgaatacggattacttttcttat
caatacgcccgctttttgcatatgcttgactggctgccgtcgcggccgccgctcgttcat
tgcgccaacagcgcggcggcccttcgtttttccgatcgagcgttcaacatggttcgcttt
ggcatttcgatgtacgggctcgccccatcgccggacatcaagccgctcctcccgtacgaa
ttgaaagaggcgttttcgctccatagccgccttgtacacgtcaaaaaactgcaaccaggc
gaaaaggtgagctacggtgcgacgtacaccgcgcagacggaagagtggatcggcacgatt
ccaatcggttatgcggacggctggctgcgaaggttgcagcactttcatgtgcttgttggc
gggcagcgggcgccgatcgtcggccgtatctgcatggaccaatgcatgatccgcctgccg
gagccgctgcctgtcgggacgaaggtgacattaattggccgccaaggggacgaagtcatt
tccatcgatgatgtcgcccgccatttgggcacaatcaattatgaagtgccgtgcacgatc
agctaccgggtgccccgtatttttttccgaaataagcgtataatggaagtgagaaacgcc
gttggccgcggatga

DBGET integrated database retrieval system