KEGG   Geobacillus sp. Y412MC52: GYMC52_0375Help
Entry
GYMC52_0375       CDS       T01399                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:gya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GYMC52_0375
Enzymes [BR:gya01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     GYMC52_0375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADU92876
UniProt: A0A0E0T8E5
LinkDB All DBs
Position
420946..422427
Genome map
AA seq 493 aa AA seqDB search
MKIQNYINGEWKEPSTGQFAPVINPATGETIAEVAMSGPNDIDEAVQAAKEAQKQWALVP
APKRAEILYKVGMLLKERKEQLARLLTMEMGKVIEEARGEVQEGIDMAFYMAGEGRRLFG
DTTPSELKDKFAMSVRTPVGVVGIITPWNFPIAIATWKSFPAIVAGNAVVWKPAPETPIM
AQELAGIFEEAGLPPGVFHVVHGDGPTVGNALVEHPDVKVISFTGSNEVGRMIAEKCGRL
LKKVSLEMGGKNAVIVMDDADLTLAVDGIIWSAFGTSGQRCTACSRVIVHERVKQELERR
LLEAVKTLKIGNGLDETVKVGPVIHEEALQKIDRYVRIGVEEGAKLLVGGYILREGDYAR
GFYYAPTIFTDVTPNMRIAREEIFGPVVSIISVRSLDEAIAVNNSVDYGLSSAIFTRDVN
NVFRAMRDLDTGIVYVNAGTTGAEIHLPFGGTKGTGNGHRDSGVAALDVFTEWRSIYVDF
SGKLQRAQIDTDD
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatccaaaactatatcaatggagaatggaaggagccaagcaccgggcaatttgcg
ccggtgatcaatccggcgacgggggaaacgattgccgaggtggcgatgtccgggccaaac
gatattgatgaggccgttcaagcagccaaagaagcgcagaaacagtgggcgctcgtgccg
gcgccgaaacgcgcggaaatcttgtataaagttgggatgctgctaaaggagcggaaagaa
cagttggcccggctgttgacgatggaaatgggcaaagtgattgaggaagcgcgcggcgaa
gtgcaggaaggcattgatatggcgttttacatggcgggagaaggacggcggttgttcggc
gatacgacgccgtctgaactgaaagacaaatttgccatgagcgtccgcacgccggttgga
gtggtcggcatcatcactccatggaattttcccattgccatcgccacttggaagtcgttt
ccggccattgttgccggcaatgcggtcgtatggaagccagcgcccgagacaccgatcatg
gcgcaggaattagctggcatttttgaagaagcgggcttgccgccgggagtgtttcatgtg
gtccacggtgacgggccgacagtcggcaatgcgctcgtcgagcatcctgatgtcaaggtc
atctcatttaccggatcgaatgaagtcgggcggatgattgcggaaaaatgcggacggctg
ttgaaaaaagtgtcgcttgaaatgggaggaaaaaacgccgtcattgtgatggatgatgcg
gatttgacattggcggttgacggcatcatctggagtgcgttcggtacatcaggccagcgg
tgcacggcgtgcagccgggtcatcgtccatgagcgggtgaaacaggagcttgagcggcgt
ctgcttgaagccgtgaaaacattgaaaatcggcaacgggttggatgaaacggtcaaagtc
ggacccgtcatccatgaagaggcgctgcaaaaaatcgaccgctacgtgcgcattggcgta
gaagaaggggcgaaactgcttgtgggtggctatatattgcgcgagggcgactatgcgcgc
ggcttttattacgcgccgacgattttcaccgatgtcacgccgaatatgcgcatcgcccgc
gaagaaattttcggcccggtcgtgtcgatcatttccgtccgcagtttggacgaagcgatc
gccgtcaacaacagcgtcgattatgggctgtcaagcgccattttcacacgcgatgtcaac
aatgtattccgagcgatgcgcgatttggacaccggcatcgtgtatgtcaacgccggcaca
acgggagcggaaattcatttgccgtttggcggcacgaaagggacgggcaacggccaccgc
gactccggcgtcgctgcgcttgacgtattcaccgaatggcggagcatttatgtcgatttc
agcggcaagctgcaacgggcgcaaatcgataccgatgattga

DBGET integrated database retrieval system