KEGG   Geobacillus sp. Y412MC52: GYMC52_0595Help
Entry
GYMC52_0595       CDS       T01399                                 

Definition
(GenBank) O-succinylbenzoate-CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00061  Fatty acid biosynthesis
gya00071  Fatty acid degradation
gya01100  Metabolic pathways
gya01212  Fatty acid metabolism
gya02024  Quorum sensing
Module
gya_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:gya00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GYMC52_0595
   00071 Fatty acid degradation
    GYMC52_0595
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GYMC52_0595
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gya01004]
    GYMC52_0595
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gya04147]
    GYMC52_0595
Enzymes [BR:gya01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     GYMC52_0595
Lipid biosynthesis proteins [BR:gya01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   GYMC52_0595
Exosome [BR:gya04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   GYMC52_0595
  Exosomal proteins of breast cancer cells
   GYMC52_0595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADU93087
UniProt: A0A0E0T9C2
LinkDB All DBs
Position
637746..639290
Genome map
AA seq 514 aa AA seqDB search
MNVTKRLAQIAKQLPDKEAYVFMKERCTYQQLDEAISRFADGLARLGVRRGDHIALLLGN
SPQFVIGLYGALRLGATVIPINPIYTPEEISYILHNGDVKAVIGLDLLAPLFVEAKKRLP
LLEHAIVCETPEGKEKGISLSEGMKSFAEVLADGSPDFTGPELDDDDVAVILYTSGTTGK
PKGAMLTHKNIYSNAQDTADYLGINENDRVIAALPMFHVFCLTVALNAPLMNGGTVLIMP
KFSPSKLFQLAREEKATIFAGVPTMYNFLYQYEGGSADDLRTLRLCISGGASMPVALLEN
FEKKFNVIISEGYGLSEASPVTCFNPLDRPRKPGSIGTNIKNVENKVVNEYGEEVPVGEV
GELVVRGPNVMKGYYKMPEETSAALRDGWLHTGDLARMDEDGYFYIVDRKKEMIIVGGYN
VYPREVEEVLYSHPDVVEAAVIGVPDPDYGEAVRAYVVAKNPELTEAELIAYCRERLAKY
KVPSAIDFLDELPKNATGKILRRALKERLASSHA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaacgaagcggttggcgcaaatcgctaagcagttgccggacaaggaagcgtat
gtgttcatgaaagagcggtgcacgtatcaacaattggacgaagccatttcccgatttgcc
gacgggttggcgcggcttggcgttcgccgaggcgaccatatcgccttgttgcttggcaac
tcgccgcagttcgtcatcggcttgtacggggcgctgcggcttggggcgaccgtcattccg
atcaatcccatttacacgcccgaggaaatttcttatattttgcacaacggcgacgtcaag
gcggtgatcggcctcgacttgctcgctccgttgtttgtggaggcgaagaagcggcttccg
ctgcttgagcatgcgatcgtttgtgaaacgccggaagggaaggaaaaaggcatttccctg
tcggaaggaatgaaatcgtttgcagaagtgttggcggacggcagcccggattttaccggc
cctgaactggatgatgacgatgtcgccgtcattttgtacacatcggggacgacgggcaag
ccgaaaggagcgatgctcactcataaaaacatatacagcaatgcgcaagatacggccgat
tatttaggcatcaacgaaaacgatcgcgtcattgccgccttgccgatgtttcatgtgttt
tgcttgaccgtggcgctcaatgccccgctgatgaacggcggaacggtgctcatcatgcca
aagttcagcccgtcgaagttgttccagctggctcgcgaggaaaaggcgacgatttttgcc
ggcgtgccgacgatgtacaatttcctttatcaatatgaaggtggaagtgcggacgatttg
cggacgctccgcctttgcatctcaggaggcgcttcgatgccggtcgccttgcttgaaaac
tttgagaaaaagttcaatgtcatcatctcggaagggtacgggctctcggaggcgtccccc
gtcacctgcttcaatcctctcgatcggccgcgcaaacccggttcgatcggaacgaacatt
aaaaacgttgaaaataaggtcgtcaacgaatacggagaagaagtgcccgtcggcgaagtt
ggcgagcttgtcgttcgcgggccgaacgtcatgaaagggtactacaaaatgcctgaagag
acctcggccgccttgcgcgacggctggctgcacaccggcgatttggcgcgcatggatgag
gacggctatttctatatcgtcgaccgaaagaaagagatgattatcgtcggcggctacaac
gtgtatccgcgcgaagtcgaagaagtgctgtacagccatccggatgttgttgaagccgcg
gtgatcggcgtgccggacccggattacggagaggcggtgcgggcgtatgtcgtcgcgaaa
aatccggagctgacggaagcagagctcatcgcttactgccgtgagcgattggcaaaatat
aaagtgccgagcgcgattgactttttggacgagctgccgaaaaacgcgacaggcaaaatt
ttgcgaagagcgttaaaagagcggctcgcgtcttcccacgcttga

DBGET integrated database retrieval system