KEGG   Geobacillus sp. Y412MC52: GYMC52_0870Help
Entry
GYMC52_0870       CDS       T01399                                 

Definition
(GenBank) aminotransferase class I and II
  KO
K08969  aminotransferase [EC:2.6.1.-]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00270  Cysteine and methionine metabolism
gya01100  Metabolic pathways
Module
gya_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:gya00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    GYMC52_0870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gya01007]
    GYMC52_0870
Enzymes [BR:gya01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     GYMC52_0870
Amino acid related enzymes [BR:gya01007]
 Aminotransferase (transaminase)
  Class I
   GYMC52_0870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADU93346
UniProt: A0A0E0T9M8
LinkDB All DBs
Position
908668..909855
Genome map
AA seq 395 aa AA seqDB search
MTMEIPFSELLEQLPKQFFASLVAKVGEKIKAGCDVINLGQGNPDQPTPKHIVEAMQRAA
ANPKYHKYSPFQGYFFLKEAIAAFYAREYGVNIDPDREVAILFGGKAGLVELPLCLVNPG
DVVLVPDPGYPDYWSGIALARARMEMMPLVAENGFLPDYEAIPAAVADQAKLMFLNYPNN
PTGATATKEFFAETVAFAAKHGIAVVHDFAYGAIGFDGRKPVSFLEVDGAKDVGVEIYTF
SKTYNMAGWRVAFAVGNERIIRALELLQDHLYVSLFGAIQEAAAAALLGPQDCVTELVAL
YEARRNAFIAALCEAGWEVQAPSGSFFAWLPLPKGISSAEFADMLLERAHVAVAPGIGFG
EHGEGYVRVGLLTDEARLREAAERIGRLGLFEKNF
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgacgatggaaattcctttttccgagttgcttgagcagctgccaaagcaatttttcgcc
tcgcttgtcgcaaaagtcggggagaaaatcaaggccggatgcgacgtgatcaatttaggg
caaggcaacccggatcagccgacgccaaagcatatcgttgaggcgatgcagcgggcggcg
gccaatccgaaataccataaatattcgccgtttcaaggctacttctttttgaaagaagcc
atcgccgcgttttacgcgcgtgaatacggggtgaacatcgatccagaccgcgaagtcgcc
attttgttcggcggcaaggccgggcttgtcgaactgccgctttgcctcgtcaacccgggc
gatgtggtgcttgtcccggacccgggctatccggactattggtcggggatcgcgcttgcc
cgcgcgcggatggaaatgatgccgcttgttgcggaaaacggttttttgccggactatgaa
gccattccggcggcagtggccgaccaagcgaagctcatgtttttaaactatccgaacaat
ccgaccggcgcgacggcgacaaaggaatttttcgcggagacagtggcgtttgccgccaag
cacggcattgccgtcgtgcacgatttcgcttatggggcgatcggctttgacggccggaaa
ccggtcagcttcctggaagtcgatggggcgaaagacgtcggcgtcgaaatttatacgttt
tcgaaaacatacaatatggccggctggcgtgtggcgtttgccgtcggcaacgagcggatc
attcgggcgcttgagcttttgcaggatcatttgtatgtcagcttgttcggcgccatccag
gaagcggccgccgcggcgctccttggtccgcaagattgtgtcacggagctggtcgcattg
tatgaggcgcgccgcaatgcgttcatcgctgcgctctgcgaggccggctgggaggtgcag
gcgccatccgggtcgtttttcgcctggcttccgctgccaaaaggcatatcatccgctgag
tttgccgacatgttgcttgagcgggcgcatgtcgccgtcgccccaggcatcgggttcggc
gagcacggcgaagggtatgtgcgcgtcggcctcttgaccgatgaagcgcggcttcgcgaa
gcagcggagcggatcggccgccttggattgttcgaaaaaaatttttga

DBGET integrated database retrieval system