KEGG   Geobacillus sp. Y412MC52: GYMC52_0923Help
Entry
GYMC52_0923       CDS       T01399                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00020  Citrate cycle (TCA cycle)
gya00310  Lysine degradation
gya00380  Tryptophan metabolism
gya01100  Metabolic pathways
gya01110  Biosynthesis of secondary metabolites
gya01120  Microbial metabolism in diverse environments
gya01130  Biosynthesis of antibiotics
gya01200  Carbon metabolism
Module
gya_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gya_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GYMC52_0923
  09105 Amino acid metabolism
   00310 Lysine degradation
    GYMC52_0923
   00380 Tryptophan metabolism
    GYMC52_0923
Enzymes [BR:gya01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     GYMC52_0923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ADU93394
UniProt: A0A0E0T9K7
LinkDB All DBs
Position
959964..962816
Genome map
AA seq 950 aa AA seqDB search
MAKQTNYAQPWSQFYGPNLGYVIEMYEQYLDDPNSIDPELKQLFEQWGAPVLEEPVSPAD
DEATKTHQTFRLPETPTIFSKLVAAVKLADSIRHYGHLAADTNPLVKKEKKLRRLELDEY
DLTEEDLKRIPVAFLCPHAPAHVKNGWDAILHLRKIYTDKIAFEFSQVHNLEERNWLIQQ
IESGAYYPSLANKERVALLRRLTEVEGFEKFIHRTYVGQKRFSIEGLDSMVPLLDELVRQ
AIEHEIDAVNIGMAHRGRLNVLAHVLGKPYEMIFAEFQHAESKNFIPSEGSVAITYGWTG
DVKYHLGAARRLRNKSAHTMRITLANNPSHLEVVNPVVLGYTRAAQEDRTKPGVPVQNTD
ASFAILIHGDAAFPGQGIVAETLNLSQLRGYTTGGTIHIIANNMIGFTTESYDSRSTTYA
SDMAKGFEVPIVHVNADDPEACLAAACLAFAYRQRFKKDFVIDLIGYRRFGHNEMDEPMA
TNPTMYAIINQHPTVRQLYAQKLMEKGIITEREVDEMEQEVAERLKIAYERVPKNEDELD
FIMDPPKPVVDRLPEVKTGVAKDVLHRVNEELLQFPDGFNVFNKLERILKRRSGVFAQNG
KVDWAHAEILAFATILQDGVPIRLTGQDSQRGTFAQRHLVLHDVKTGEEYVPLHHISGAK
ASFVVYNSPLTEAAVLGYEYGYNVYAPETLVLWEAQFGDFANMAQVMFDQFISSGRAKWG
QKSGLVMLLPHGYEGQGPEHSSGRVERFLQLAAENNWTVANLSTAAQYFHILRRQAALLT
REEVRPLIIMTPKSLLRHPLAASDAEAFVDGAFSPVLEQPGLGADAGKVERIVFGTGKLM
IDLAEQIGKMEGLDWLHIVRIEELYPFPEEAVKDIIARYPNVKELVWVQEEPKNMGAWLY
MEPRLRALAPEGVDVSYIGRRRRASPAEGDPVVHRKEQERIIRCALTKHE
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacagacgaactacgctcaaccgtggagccagttttacgggccgaacctcggt
tatgtcatcgaaatgtacgaacagtatctcgatgaccctaacagcatcgacccggaactg
aagcaactgtttgaacagtggggggcgccggtcttggaagaaccggtttctcctgcggat
gacgaggcgaccaaaacgcatcaaacgttccggctgccggagacgccgacgattttcagc
aagcttgtcgctgccgtcaagctggcggacagcattcgccattacggccatctggctgcc
gatacgaatccgcttgtcaaaaaggagaaaaagctgcgccgcttggagcttgacgaatac
gacttaaccgaagaggatttaaagcgcattccggtcgcgtttctttgcccgcacgctccg
gcgcatgtcaaaaacggctgggacgccatcttgcatttgcgcaaaatttacacggacaaa
atcgcgtttgaattctcgcaagtacataatctcgaagagaggaactggctcattcagcaa
atcgagtccggagcgtattacccgagcttggcgaacaaagagcgggttgctttgttgcgc
cgcctgacggaagtggaagggtttgaaaagttcatccaccggacgtatgtcgggcaaaaa
cggttttcgatcgaagggcttgattccatggtgccgcttttggatgagcttgttcgccaa
gcgatcgaacatgaaattgacgccgtcaacatcggcatggcgcaccgcggccggttgaac
gtgctggctcacgtgctcggcaagccgtacgaaatgattttcgccgagtttcagcatgcg
gaaagcaaaaatttcattccgtctgaaggatcagtggcgatcacgtacgggtggacgggc
gatgtcaaataccacttaggggcggcgcgccgccttcgcaataaaagcgcgcatacgatg
cggattacgctcgcgaacaacccaagccatctcgaagtggtcaatccggttgtgcttggc
tacacgcgcgccgcgcaagaagatcggacaaaaccaggagtgccggtgcaaaatactgat
gcgtcgtttgccatcttgattcacggcgatgccgcgttcccgggacaagggatcgtcgcg
gaaacgctcaacttaagccagctgcgcggctatacgaccggcgggacgatccatatcatc
gccaataacatgatcggctttacgacggagagttacgattcacgctcgacgacgtatgct
tccgatatggcgaaagggtttgaggtgccgattgtgcacgtcaatgccgacgacccggag
gcttgtttggcggccgcatgcttggcgtttgcctaccgccagcggtttaaaaaagacttt
gtcattgacctaatcggttaccgccgcttcggtcataatgaaatggatgagccgatggcg
acgaacccgacgatgtacgcgatcatcaaccaacatccgaccgtacgccagctgtatgcg
caaaaattgatggaaaaagggatcatcaccgagcgggaagtcgacgaaatggagcaagag
gtggccgaacggctgaaaatcgcctacgagcgggtgccgaaaaacgaagacgaactcgat
ttcatcatggatccgcccaaaccggtcgtcgatcggctgccggaagtgaaaacgggcgtg
gcgaaagacgtgctccatcgtgtgaacgaagaattgctgcagtttccggacggattcaac
gtctttaacaagcttgagcgcattttaaaacggcgaagcggcgtgtttgcgcaaaacggc
aaagtcgattgggcgcacgcggaaattttagcgtttgccacgattttgcaagacggcgtg
ccgatccgcttgaccgggcaagattcacagcgcggcacgtttgcgcagcgccatttggtg
ctccatgacgtgaaaaccggagaagagtatgtgccgcttcaccacatcagcggcgccaaa
gcgtcgtttgtcgtgtacaacagcccgctgacggaagccgctgtgctcggctatgaatac
ggctacaacgtttacgcgccggagacgctcgtgctttgggaagcgcaatttggcgacttc
gccaacatggcgcaagtgatgtttgatcaattcatttcatccggccgggcgaaatggggg
caaaaatccgggcttgtcatgctattgccgcacggctacgaagggcaaggccctgaacat
tcaagcggccgcgtcgagcgctttttgcagctggcggcggaaaacaactggacggttgcc
aacttatcgacggccgcgcaatatttccatattttgcggcggcaggcggcgctgttgaca
agagaagaagtgcgtccgctcatcattatgacgccaaaaagcttgctccgccatccgctg
gcagcgtcggatgcggaagcgttcgttgacggtgcgttctcgccggtgctcgaacagccg
ggattgggcgctgacgctggcaaagtggaacgcatcgtgtttggcaccggaaaattgatg
atcgatttggcggaacaaatcggcaaaatggaaggtcttgactggctgcatatcgtgcgc
attgaagagctgtatccgttcccggaagaagcggtgaaagacatcatcgcccgctatccg
aacgtcaaagagctcgtctgggtgcaagaagaaccgaaaaacatgggggcatggctgtat
atggaaccgcgcctgcgggcgttggctccagagggtgtcgatgtcagttacattgggcgg
cgccggcgggccagcccggcggaaggcgatccggtcgtccaccgaaaagagcaagagcgc
atcatccgctgtgcattgacgaagcatgaatga

DBGET integrated database retrieval system