KEGG   Geobacillus sp. Y412MC52: GYMC52_1080Help
Entry
GYMC52_1080       CDS       T01399                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor(s)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
gya  Geobacillus sp. Y412MC52
Brite
KEGG Orthology (KO) [BR:gya00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gya01001]
    GYMC52_1080
Enzymes [BR:gya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     GYMC52_1080
Protein kinases [BR:gya01001]
 Serine/threonine kinases: Other
  Bacterial family
   GYMC52_1080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Kinase-like APH Kdo Seadorna_VP7 RIO1 FTA2 PIP49_C Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: ADU93547
UniProt: A0A0E0TAQ2
LinkDB All DBs
Position
1114244..1116250
Genome map
AA seq 668 aa AA seqDB search
MLIGKRLNDRYKIISLIGGGGMANVYLARDMILERDVAVKVLRLDFANDDQFIKRFRREA
QAATSLNHEHIVSIYDVGEEEGVYYIVMEYVRGATLKQYIQQHAPLPVERALGIMDQLTS
AIAHAHENGIIHRDIKPQNILLDEHGNVKVTDFGIAVAMSGTTITQTNSVLGSVHYLSPE
QARGGIATEKSDIYSLGIVMFELVTGRLPFSGESAVSIVLKHLQAETPPPKAWNPDIPQS
VENIILKATAKDPFYRYQSAREMNEDIRTALDPRRRNEPKFTIPDDDEEATKAIPMIKHA
ESAALEQETLVYEEKTSEPVHTTGEPKPKRKRAWIAWLVAALLFIGAAGVSAVTWIPGLI
FPKEVTMPNVVNKNYDDAVEQLSSLGLEIKDTIDVEDDQIEEGKVVRTDPEAGMTVKKGA
GVIIYKSIGKKKIEFPSFIGDDIAAAEEELRAEGFTRITRSGRYSDKPEGTILDQYPYAG
DEVVPDETEVMFTVSLGPEKVTVKDLTGYTEKSVRDYGADQGLRIDVKYEYSDEVPEGLV
ISQTPAANEQVKKGETITVVISRGPEPKPSKTVVKEIMIPYEPAMPGQMVEAQLYIQDAN
HNMSTPYKTYRLTAPATEMVEFEIPYGETAYYRVIVNNVVKEEGSIPYPENNEKKGVRLW
RKDKSLKH
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
gtgctcattggaaagcgattgaatgaccgctataaaatcatcagcctcatcggcggcggc
ggcatggccaacgtgtatttggcccgcgatatgattttggagcgcgatgttgctgtcaaa
gtgctccgccttgattttgccaatgatgatcagttcatcaaacggttccgccgcgaggcg
caagcggcgacgagcttaaaccatgaacatatcgtctccatttatgacgtcggcgaagag
gaaggcgtctattacatcgtcatggaatatgtgcgcggcgcgacgctgaagcaatacatc
cagcagcacgctccgcttccggtcgaacgggcgcttggcatcatggaccagctgacatcg
gcgatcgcccatgcccatgagaacggcatcatccatcgcgacattaaaccgcaaaacatt
ttgcttgatgagcacggcaatgtgaaagtgaccgacttcggcatcgctgtggcgatgagc
ggcacgacgatcacgcagaccaactcggtgctcggttcggttcattatttgtcgccggag
caggcgcgcgggggcatcgctactgaaaaatcggacatttattcactcggcattgtcatg
tttgaactcgtcaccggtcggctgccgttttccggcgaatcagccgtttcgatcgtgttg
aagcacttgcaggcggaaacgccgccgccgaaggcgtggaatcccgacatcccgcaaagt
gtggaaaacattattttaaaagcgacggcgaaagacccgttttaccgctaccaatccgcg
cgcgaaatgaacgaggacattcggacagcgctggatccaaggcggcgcaacgagccgaaa
tttaccatacccgatgacgatgaggaagcgacgaaagccattccgatgatcaaacatgcg
gaaagcgcggcgttggagcaagagacgcttgtgtacgaggaaaaaacgagcgaaccggtt
catacgacgggcgaaccgaaaccaaagcggaaacgggcatggatcgcctggcttgtggct
gccttgctgttcattggagctgccggcgtcagcgcggtcacatggattccgggcctcatt
tttccaaaagaagtgacgatgccgaacgtggtcaacaaaaactatgatgacgctgttgaa
cagctgtcgtcgctcggtttggaaatcaaagatacgattgatgtggaagatgatcaaatc
gaagaaggaaaagtcgtgcgcaccgatccggaagccggcatgacggtgaagaaaggggcc
ggcgtcatcatttataaaagcattggaaaaaagaaaatcgaatttccaagcttcattggc
gatgatattgctgcggcggaggaggagctgcgcgccgaaggatttacccgcatcacacgc
agcggccgctacagcgacaagccggaagggacgattttggatcaatacccgtacgccggt
gatgaagtcgtgcctgatgaaacggaagtgatgttcaccgtcagcctcgggccggagaag
gtcaccgttaaagatttgactggctatacggaaaaaagcgtgcgcgactacggcgcggat
caagggctgcgcattgacgtgaagtacgagtattcggacgaggtgccagaagggcttgtc
atttcgcaaactccagcggcgaacgagcaggtaaaaaaaggggaaaccatcacggtcgtc
atttcccgcgggccggagccgaagccgtccaaaacggtagtgaaagagattatgatcccg
tatgaaccggcgatgccggggcaaatggttgaagcccagctttacatccaagatgccaac
cacaatatgtcaacgccatacaaaacataccggctgacggcgccagcgaccgagatggtc
gagtttgaaattccatatggggagaccgcttattaccgcgtcattgtcaacaatgtcgtc
aaagaggaaggatcgatcccgtacccagaaaataacgaaaaaaaaggggtgaggctatgg
cggaaggacaaatcattaaagcattaa

DBGET integrated database retrieval system