KEGG   Geobacillus sp. Y412MC52: GYMC52_1567Help
Entry
GYMC52_1567       CDS       T01399                                 

Definition
(GenBank) Carbamoyl-phosphate synthase L chain ATP-binding protein
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00061  Fatty acid biosynthesis
gya00620  Pyruvate metabolism
gya00640  Propanoate metabolism
gya01100  Metabolic pathways
gya01110  Biosynthesis of secondary metabolites
gya01120  Microbial metabolism in diverse environments
gya01130  Biosynthesis of antibiotics
gya01200  Carbon metabolism
gya01212  Fatty acid metabolism
Module
gya_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:gya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GYMC52_1567
   00640 Propanoate metabolism
    GYMC52_1567
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GYMC52_1567
Enzymes [BR:gya01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     GYMC52_1567
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     GYMC52_1567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK ATP-grasp_3 ATP-grasp_5 ATP-grasp_4 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ADU94016
UniProt: A0A0E0TBL6
LinkDB All DBs
Position
1614827..1616179
Genome map
AA seq 450 aa AA seqDB search
MFSKVLIANRGEIAVRVIRTCRRLGIQTVAIYSEADADSLHVSLADEAYLIGKPRVAESY
LNIEKIIEVAKTAKAEAIHPGYGLLSENPAFARRCEEEGIVFIGPKADVIAAMGSKIEAR
RTMEKAGVPIVPGVSFALDGADEAAKAAASIGYPVMLKASAGGGGIGMHIARDEAELRQA
FEGSQKRAASFFGDGTMYIEKYIERPRHIEIQLLADQNGNCVYLWERECSIQRRHQKVVE
EAPSPFLDEETRRKMGEAAVRAARYIGYANAGTIEFLVDEQKNFYFLEMNTRLQVEHPVT
EEITGIDIVEEQLRIAAGEPLRYKQEEIRRDGHAIEVRIYAEDPNTFYPSPGRIAVFSAP
QGEWIRHETAVQSGITVTPFYDPMIAKLIAKGPDRQTAIERLLEALRDYRVEGIKTNIPL
LEAVLSHPAFQAGDTTTDFLSKHWKPIKTK
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgttttcgaaagtgttgattgccaaccgcggcgaaatcgccgtccgtgtcatccgcacg
tgccgacgtctcggcattcaaacggttgccatttattccgaagcagacgccgattcgctt
catgtctcgctcgcggatgaagcgtatttgatcggcaagccgcgcgtcgcggaaagctat
ttaaatatcgaaaaaatcattgaggttgccaaaacggcgaaagcggaggcgatccatcca
ggctacgggctgttgtcggaaaatccagcgtttgcccgccgttgcgaggaagaaggaatc
gtcttcatcggtccgaaggcggacgtcattgcggcgatgggcagcaaaatcgaagcgcgg
cggacgatggaaaaagccggcgtgccgatcgtcccgggcgtctcctttgcgcttgatggc
gccgatgaggcggccaaagcggcggcttcgattgggtatccagtcatgctgaaggcgtca
gccggcggcggcggcatcggcatgcatatcgctcgcgatgaagctgagctgcgccaagcg
tttgaagggagccaaaaacgggccgcttcgtttttcggcgacgggacgatgtacattgaa
aaatatattgaacgcccgcgccatattgaaattcagcttcttgccgaccaaaatggcaac
tgtgtttacttatgggagcgtgaatgttcgatccaacgccgccaccaaaaagtggtcgaa
gaggcgccgtcgccgtttttggatgaagagacgcggcggaagatgggggaggcggcggtg
cgggctgcgcgttacatcggttatgcaaatgccggtaccattgaatttctcgtcgatgaa
cagaaaaatttttattttcttgagatgaacactcggctgcaagtcgagcacccggtgaca
gaagaaatcaccggcatcgacatcgtcgaagagcagctgcgcatcgccgcgggcgagccg
ctccgctataaacaagaagagattcgccgcgacggtcacgccattgaagtgcgcatttat
gccgaagatccgaacacgttttacccgtcgcccggccgcattgcggtgttttccgcccca
caaggcgaatggattcgtcatgaaacggcggttcaaagcggcatcacggtcacgccgttt
tatgatccgatgatcgcgaagttgattgcaaaagggccggatcggcaaacggcgattgaa
cgcttgctcgaagcgcttcgagactatcgcgttgaagggattaaaacgaacattccgctg
cttgaggccgtgttgtcccatccggcgtttcaagcgggggatacgacgaccgatttcctt
tcgaaacattggaaaccaataaaaacgaaatga

DBGET integrated database retrieval system