KEGG   Geobacillus sp. Y412MC52: GYMC52_2133Help
Entry
GYMC52_2133       CDS       T01399                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00564  Glycerophospholipid metabolism
gya01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gya00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    GYMC52_2133
Enzymes [BR:gya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     GYMC52_2133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored NAD_binding_8 Pyr_redox_2 3HCDH_N FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ADU94535
UniProt: A0A0E0TCX7
LinkDB All DBs
Position
complement(2215018..2216691)
Genome map
AA seq 557 aa AA seqDB search
MAFSSKHRSDVLQAMSEKQYDLLIIGGGITGSGIALDAISRGMTVALVEMQDFAAGTSSR
STKLVHGGLRYLKQFEVKLVAEVGRERAIVYENGPHVTTPEWMLLPIYRGGTFGKWSTSI
GLWLYDRLAGVKQSERRTMLNARQTLEKEPLLKRDGLIGGGYYVEYRTDDARLTIEVIKK
AVELGADAVNYVKAEQFLYDERGRAIGARCRDMLGGLLYDIRAKKVVNAAGPWVDALRDK
DGSKTGKRLRLTKGVHIVIDQKRFPLKQAVYFDTPDGRMVFAIPRDGKTYVGTTDTFYDD
DPAHPAMTEEDRDYLLQAIHYMFPSVGVTADDVESSWAGVRPLIYEEGKDPSEISRKDEI
WTSPSGLITIAGGKLTGYRKMAETVVDLVAKQLEKEEGKAFGPCRTKQLPISGGDVGGSH
RLPAFIAEKAEEAVRYGLTKEAGARLARQYGTNVDRLFALSQQYDRSSGLTRETFIRLVY
AIEEEMAAKPVDYFIRRTGALLFDIDSVRREKEEVMAFMARYLGWTGEERDVYEKELDKE
LRRAVLGRSGVNDPLKE
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctcaagcaaacatcggagcgatgttcttcaagcgatgagcgaaaaacaatat
gatcttctgatcatcggtggagggatcaccggctctggcatcgcccttgatgccatctcc
cgcggcatgacggtcgcgcttgtcgagatgcaagattttgccgccggcacgtcaagccgg
tcgacgaagctcgttcacggcggcttgcgctacttgaagcagttcgaggtgaagcttgtc
gcggaagtcgggcgcgaacgggcgattgtgtatgaaaacggcccgcacgtcaccacaccg
gagtggatgctgctgcccatttaccgcggcgggacgttcggcaaatggagcacgtcgatc
ggcctttggctgtatgaccggctggctggcgtcaagcaaagcgagcggcgcacgatgctt
aatgcccggcagacgttggaaaaagagccgctcttaaagcgcgacggcctgatcggcggc
ggctattacgtcgagtatcggaccgacgatgcccgcttgacgatcgaagtgatcaaaaaa
gcggtcgagcttggcgccgacgccgtcaactacgtaaaagccgaacagtttttgtatgac
gagcgcggccgcgcgatcggcgcccgctgccgcgacatgctcggcggcctcttgtatgac
atccgcgccaaaaaagtcgtcaatgccgccggaccgtgggtggatgcgctgcgcgacaaa
gacggatcgaaaaccggcaagcggcttcggctgacaaaaggcgtccatatcgtcatcgat
caaaagcgttttccgctcaagcaggcggtctattttgacaccccggacggccggatggtg
tttgccattccgcgggatgggaaaacgtatgtcggcacgaccgatacattttatgacgat
gaccccgctcatccggccatgaccgaagaagaccgtgattacttattgcaggcgattcac
tacatgttcccgtccgtcggcgtcactgccgacgatgtcgagtcgagctgggctggcgtc
cgtccgctcatttatgaagaagggaaagacccgtcggaaatttcccgcaaagacgaaatt
tggacatcgccatccggcctcattacgatcgccggcggcaaactgaccggctaccggaaa
atggccgagaccgtcgtcgatcttgtcgccaagcagctggagaaagaagaaggaaaagcg
ttcggaccgtgtcgaacgaaacaattgccgatctccggcggcgatgtcggcggctcgcac
cgcctccctgccttcatcgccgaaaaagcggaagaagcggtgcgctatggattgacgaaa
gaagcgggagcgcggctggcgagacaatacggcacaaatgtcgaccggctgtttgcttta
agccagcaatacgaccgttcatccggtctgacgcgtgaaacgttcatccgcctcgtctac
gccattgaggaagaaatggcggccaaaccagtcgactacttcatccgccgcaccggagcg
ctgttgtttgatattgattctgtccggcgtgagaaagaggaggtcatggcgtttatggcg
cggtatttggggtggacgggggaagagcgggacgtgtatgagaaagaactcgacaaggaa
ctgcggcgtgcggtgttggggaggagcggagtgaatgatcctttgaaggaatga

DBGET integrated database retrieval system