KEGG   Geobacillus sp. Y412MC52: GYMC52_2770Help
Entry
GYMC52_2770       CDS       T01399                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00020  Citrate cycle (TCA cycle)
gya00480  Glutathione metabolism
gya01100  Metabolic pathways
gya01110  Biosynthesis of secondary metabolites
gya01120  Microbial metabolism in diverse environments
gya01130  Biosynthesis of antibiotics
gya01200  Carbon metabolism
gya01210  2-Oxocarboxylic acid metabolism
gya01230  Biosynthesis of amino acids
Module
gya_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gya_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:gya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GYMC52_2770
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GYMC52_2770
Enzymes [BR:gya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     GYMC52_2770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ADU95147
UniProt: A0A0E0TFD9
LinkDB All DBs
Position
complement(2825946..2827217)
Genome map
AA seq 423 aa AA seqDB search
MTQGEKITVQNGVLNVPNNPIIPFIEGDGTGPDIWAAASRVLEAAVEKAYKGEKKIVWKE
VLAGEKAYKLTGSWLPDETLETIREYIIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFPGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGTPEVKKVIDFLQNEMGVRKIR
FPETSGIGIKPISEQGTKRLVRAAINYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EEEFADKVFTWAQYDRIVETEGKEAANKALADAEASGKIIIKDVIADIFLQQILTRPREF
DVIATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVMMFEHLGWNEAAKLIIKAMEKTIAAKIVTYDFARLMEGATEVKCSEFADALIR
NMD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaaggagaaaaaattacagtccaaaatggtgtgctcaacgttccgaacaacccg
atcattccgttcatcgagggggatggaaccggcccggacatttgggcggccgcttcgcgc
gtgctcgaagcagcggtggaaaaagcgtacaaaggtgagaaaaaaatcgtttggaaggaa
gtgctcgctggtgaaaaagcgtacaagctgacgggcagctggcttccggatgaaacgctt
gagacgatccgcgaatacataatcgccattaaagggccgttgacgacgccggtcggcggc
ggcatccgctcgctgaacgtcgcgctccgccaagagctcgacctgtttgtctgcttgcgt
ccggttcgctacttcccaggcgttccgtcgccggtgaaacgcccggaagacaccgatatg
gtcattttccgggaaaacacggaagacatctacgctggcattgaatatgccaaaggcacg
ccggaagtgaaaaaagtcatcgactttttgcaaaatgaaatgggcgtgcgcaaaatccgc
ttcccggaaacgtccggcatcggcattaaaccgatttccgaacaagggacgaaacggctt
gtgcgcgcggcgatcaactacgcgatcgaacacggccgcaagtcggtgacgctcgttcat
aaagggaatattatgaaattcaccgaaggcgcgtttaaaaactggggttatgaactggcg
gaggaagaattcgccgacaaagtgttcacgtgggcgcaatacgaccgaatcgttgaaacg
gaaggcaaggaagcggcgaacaaagcgcttgctgatgcggaagcgtccggcaaaatcatt
atcaaagatgtcatcgccgacatcttcctgcaacaaattttgacgcgtccgcgcgaattt
gacgtcatcgcgacgatgaacttaaacggcgactacatttccgacgcgctggccgctcaa
gtcggcggcatcggcatcgcgccgggggcaaacatcaactacgaaaccggccacgcgatt
ttcgaagcgacgcacggcacggcgccgaaatacgcagggcttgacaaagtcaacccgtcg
tccgtcattctctcgggcgtcatgatgtttgagcatcttggttggaacgaagcagcgaaa
ttgatcatcaaagcgatggagaaaaccatcgccgcgaaaatcgtcacgtatgacttcgcc
cgcctgatggaaggggcgacggaagtgaaatgctccgaatttgctgatgcgctcatccgc
aatatggactaa

DBGET integrated database retrieval system