KEGG   Geobacillus sp. Y412MC52: GYMC52_3179Help
Entry
GYMC52_3179       CDS       T01399                                 

Definition
(GenBank) phosphoribosyl-ATP diphosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00340  Histidine metabolism
gya01100  Metabolic pathways
gya01110  Biosynthesis of secondary metabolites
gya01230  Biosynthesis of amino acids
Module
gya_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:gya00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    GYMC52_3179
Enzymes [BR:gya01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     GYMC52_3179
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     GYMC52_3179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG DUF3239
Motif
Other DBs
NCBI-ProteinID: ADU95535
UniProt: A0A0E0TFS3
LinkDB All DBs
Position
complement(3206653..3207303)
Genome map
AA seq 216 aa AA seqDB search
MTADIRFDEKGLVPAIVQDAQSKEVLTLAYMNKESLEKTLETGETWFYSRSRQELWHKGA
TSGNVQRVVDIRYDCDADALLVLVEPAGPACHTGSYSCFSRSLDGAARTPAADRFAILNE
LEQIIAKRDAERPEGSYTTYLFEKGVDKILKKVGEEAAEVIIAAKNQNHEELKWEAADLL
YHLLVLLREQKLPLDAVLATLAERHAQKVGAGDKKE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgacggcggacattcgctttgatgaaaaagggcttgtacccgcgatcgtccaagatgcg
caaagcaaggaagtgctcacgctcgcctatatgaacaaagagtcgcttgaaaaaacgctg
gagaccggagaaacatggttttacagccgctcgcgccaagaactatggcataaaggggcg
acatctggaaacgtgcagcgcgttgtcgacatccgctacgactgcgacgccgacgccctg
ctcgttctcgtcgagccggccggcccggcttgccataccgggtcgtattcctgtttttcc
cgctcgttggacggcgcggcgcgcacgccggcggccgaccggttcgccattttgaacgag
ttggaacagatcatcgccaagcgcgacgccgaacggccggaagggtcgtacacgacgtac
ttgtttgaaaaaggcgtcgataaaattttgaagaaagtcggcgaagaagcggcggaagtc
atcatcgccgccaaaaaccaaaaccacgaggaattgaaatgggaagcggccgacttgttg
taccatttgcttgtgctgttgcgcgaacaaaagctgccgcttgacgcggtgcttgcgacg
cttgccgagcggcacgcgcaaaaggtgggagcgggcgacaaaaaagaataa

DBGET integrated database retrieval system