KEGG   Geobacillus sp. Y412MC52: GYMC52_3303Help
Entry
GYMC52_3303       CDS       T01399                                 

Definition
(GenBank) alpha amylase catalytic region protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00500  Starch and sucrose metabolism
gya01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GYMC52_3303
Enzymes [BR:gya01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     GYMC52_3303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: ADU95655
UniProt: A0A0E0TG35
LinkDB All DBs
Position
3335827..3337476
Genome map
AA seq 549 aa AA seqDB search
MLTFHRIIRKGWMFLLAFLLTASLFCPTGQPAKAAAPFNGTMMQYFEWYLPDDGALWTKV
ANEANNLSSLGITALWLPPAYKGTSRSDVGYGVYDLYDLGEFNQKGTVRTKYGTKAQYLQ
AIQAAHAAGMQVYADVVFDHKGGADGTEWVDAVEVNPSDRNQEISGTYQIQAWTKFDFPG
RGNTYSSFKWRWYHFDGVDWDESRKLSRIYKFRGIGKAWDWEVDTENGNYDYLMYADLDM
DHPEVVTELKNWGKWYVNTTNIDGFRLDAVKHIKFSFFPDWLSYVRSQTGKPLFTVGEYW
SYDINKLHNYITKTNGTMSLFDAPLHNKFYTASKSGGAFDMRTLMTNTLMKDQPTLAVTF
VDNHDTEPGQALQSWVDPWFKPLAYAFILTRQEGYPCVFYGDYYGIPQYNIPSLKSKIDP
LLIARRDYAYGTQHDYLDHSDIIGWTREGVTEKPGSGLAALITDGPGGSKWMYVGKQHAG
KVFYDLTGNRSDTVTINSDGWGEFKVNGGSVSVWVPRKTTVSTIAWPITTRPWTGEFVRW
TEPRLVAWP
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
gtgctaacgtttcaccgcatcattcgaaaaggatggatgttcctgctcgcgtttttgctc
actgcctcgctgttctgcccaacaggacagcccgccaaggctgccgcaccgtttaacggc
accatgatgcagtattttgaatggtacttgccggatgatggcgcgttatggaccaaagtg
gccaatgaagccaacaacttatccagccttggcatcaccgctctttggctgccgcccgct
tataaaggaacaagccgcagcgacgtagggtacggagtatacgacttgtatgacctcggc
gaattcaatcaaaaagggaccgtccgcacaaaatacggaacaaaagctcaatatcttcaa
gccattcaagccgcccacgccgctggaatgcaagtgtacgccgatgtcgtgttcgaccat
aaaggcggcgccgacggcacggaatgggtggacgccgtcgaagtcaatccgtccgaccgc
aaccaagaaatctcgggcacctatcaaatccaagcatggacgaaatttgattttcccggg
cggggcaacacctactccagctttaagtggcgctggtaccattttgacggcgttgattgg
gacgaaagccgaaaattgagccgcatttacaaattccgcggcatcggcaaagcatgggat
tgggaagtagacacggaaaacggaaactatgactacttaatgtatgccgaccttgatatg
gatcatcccgaagtcgtgaccgagctgaaaaactgggggaaatggtatgtcaacacaacg
aacattgatgggttccggcttgatgccgtcaagcatattaagttcagtttttttcctgat
tggttgtcgtatgtgcgttctcagactggcaagccgctatttaccgtcggggaatattgg
agctatgacatcaacaagttgcacaattacattacgaaaacaaacggaacgatgtctttg
tttgatgccccgttacacaacaaattttataccgcttccaaatcagggggcgcatttgat
atgcgcacgttaatgaccaatactctcatgaaagatcaaccgacattggccgtcaccttc
gttgataatcatgacaccgaacccggccaagcgctgcagtcatgggtcgacccatggttc
aaaccgttggcttacgcctttattctaactcggcaggaaggatacccgtgcgtcttttat
ggtgactattatggcattccacaatataacattccttcgctgaaaagcaaaatcgatccg
ctcctcatcgcgcgcagggattatgcttacggaacgcaacatgattatcttgatcactcc
gacatcatcgggtggacaagggaaggcgtcactgaaaaaccaggatccggactggccgca
ctgatcaccgatgggccgggaggaagcaaatggatgtacgttggcaaacaacacgccgga
aaagtgttctatgaccttacgggcaaccggagtgacaccgtcaccatcaacagtgatgga
tggggagaattcaaagtcaatggcggttcggtttcggtttgggttcctagaaaaacgacc
gtctctaccatcgcttggccgatcacaacccgaccgtggactggtgaattcgtccgttgg
accgagccacggttggtggcatggccttga

DBGET integrated database retrieval system