KEGG   Geobacillus sp. Y412MC52: GYMC52_3306Help
Entry
GYMC52_3306       CDS       T01399                                 

Definition
(GenBank) hypothetical protein
Organism
gya  Geobacillus sp. Y412MC52
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF812 DUF3552 ATG16 HemX SlyX CALCOCO1 YlbD_coat DUF4351 DUF4763 HrpB7 WASH_WAHD Allexi_40kDa Matrilin_ccoil DUF16 TMF_DNA_bd COG2 HMMR_N Atg14 Fib_alpha DUF2247 Lebercilin DUF3450 DUF4094 UPF0184 Tropomyosin_1 Fmp27_WPPW DUF2721 Tropomyosin Uso1_p115_C SLY DUF1664 Med21
Motif
Other DBs
NCBI-ProteinID: ADU95658
UniProt: A0A0E0TG16
LinkDB All DBs
Position
complement(3342091..3342816)
Genome map
AA seq 241 aa AA seqDB search
MLKKGWPILVASMLVASPAWAAAKPAGKAHERETMVKKVEVVVKKKTEQKETEAKKKQES
SKQQKWLAQKLAQLNKKVGQIEERLDKVTARIQALSEAEPATDTQASPTPADSSPTGEPS
ASQPTGATAATDAPSGQAIAANDAATPDSSGQTATEAPSPTSPQPVGEDQEELDEEKQAQ
IDGLIGQLIALSNQLRAVTNDIRALEKKVGANNADIQKVKEKVKALNDQVQANKKALLQL
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagaaaggatggccgattttggtggcgtcgatgctcgtcgcctctccggcgtgg
gcggccgccaagcctgctggcaaagcgcatgagcgcgaaacgatggtgaagaaagtggaa
gtcgtcgtcaagaagaagacggaacaaaaggaaacagaggcgaagaaaaaacaggaatcg
tccaagcaacaaaaatggcttgcgcaaaagttggcgcagttaaataaaaaagtaggccaa
attgaagagcggttagacaaagtgaccgctcgcattcaagcattgagcgaagcggaaccg
gcaacggatacgcaagcctcgccgacgcctgcggattcgtcaccaacgggcgagccgtcc
gcttctcaaccgacaggagccacagcggcaactgacgctccgagtggacaagccatagcg
gccaatgacgctgcaactccggattccagcgggcaaacggcaacggaggcgccgtctccg
acttctccacaacctgttggtgaagaccaagaggaactcgatgaagaaaaacaagcgcaa
atcgatggcctcatcggccagctcatcgcgctgtccaaccagctgcgggcggtgacgaat
gacattcgcgctcttgaaaagaaagtcggcgccaacaacgcagacattcagaaggtaaaa
gaaaaagtcaaggcgttgaacgatcaagtgcaagcgaacaaaaaggcgttgcttcagttg
ctgtag

DBGET integrated database retrieval system