KEGG   Geobacillus sp. Y412MC61: GYMC61_0105Help
Entry
GYMC61_0105       CDS       T01101                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
gyc  Geobacillus sp. Y412MC61
Brite
KEGG Orthology (KO) [BR:gyc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:gyc03012]
    GYMC61_0105
   03029 Mitochondrial biogenesis [BR:gyc03029]
    GYMC61_0105
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gyc04147]
    GYMC61_0105
Translation factors [BR:gyc03012]
 Eukaryotic Type
  Elongation factors
   GYMC61_0105
 Prokaryotic Type
   GYMC61_0105
Mitochondrial biogenesis [BR:gyc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    GYMC61_0105
Exosome [BR:gyc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GYMC61_0105
  Exosomal proteins of breast cancer cells
   GYMC61_0105
  Exosomal proteins of colorectal cancer cells
   GYMC61_0105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ACX76805
LinkDB All DBs
Position
127176..128363
Genome map
AA seq 395 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITTVLAKQGKAEAKAYDQIDAAPEERERG
ITISTAHVEYETDARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDEVPVIKGSALKALE
GDPQWEEKIIELMNAVDEYIPTPQREVDKPFMMPIEDVFSITGRGTVATGRVERGTLKVG
DPVEIIGLSDEPKTTTVTGVEMFRKLLDQAEAGDNIGALLRGVSRDEVERGQVLAKPGSI
TPHTKFKAQVYVLTKEEGGRHTPFFSNYRPQFYFRTTDVTGIITLPEGVEMVMPGDNVEM
TVELIAPIAIEEGTKFSIREGGRTVGAGSVSEIIE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcgaaatttgagcgcacgaaaccgcacgtcaacattggcacgatcggccac
gttgaccacgggaaaacgacgttgacagctgcgatcacgacggttttggcgaaacaaggc
aaagccgaagcaaaagcgtacgaccaaatcgacgctgctccggaagagcgtgaacgcggg
attacgatttcgacggcgcacgtcgagtatgaaacagatgctcgccactatgcgcacgtt
gactgcccgggccacgctgactacgtcaaaaacatgatcacgggcgcggcgcaaatggac
ggcgcgatccttgttgtatcggcggctgacggtccgatgccgcaaacgcgcgaacacatt
cttctctcccgccaagtcggtgttccgtacatcgttgtattcttgaacaaatgcgacatg
gtggacgacgaagaattgcttgaacttgttgaaatggaagttcgcgatcttctctctgaa
tacgacttcccaggcgatgaagtgccggtcatcaaaggttcggcattaaaagcgcttgaa
ggcgacccgcaatgggaagaaaaaatcattgaactgatgaatgcggttgacgaatacatc
ccgacgccgcaacgtgaagtggacaaaccgttcatgatgccaatcgaggacgtcttctcg
atcacgggccgcggtacggttgcaacaggccgtgttgaacgcggtacgttgaaagttggc
gacccggttgaaatcatcggtttgtcggatgagccgaaaacgacgaccgttacgggtgta
gaaatgttccgcaaacttctcgatcaagcggaagccggcgacaacatcggtgcgcttctc
cgcggcgtatctcgtgatgaagtcgagcgcggccaagtattggcgaaacctggttcgatc
acgccgcacacgaaattcaaagcgcaagtatacgtcctgacgaaagaagaaggcggacgc
catactccgttcttctcgaactaccgtccgcaattctacttccgtacgacggacgtaacg
ggcattatcacgcttccggaaggcgtcgaaatggttatgcctggcgacaacgttgaaatg
acggtggaactgatcgccccgatcgcgatcgaagaaggtacgaaattctcgatccgcgaa
ggcggccgtacggtcggcgctggctctgtatcggaaatcatcgagtaa

DBGET integrated database retrieval system