KEGG   Geobacillus sp. Y412MC61: GYMC61_0394Help
Entry
GYMC61_0394       CDS       T01101                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gyc  Geobacillus sp. Y412MC61
Brite
Enzymes [BR:gyc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GYMC61_0394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACX77076
LinkDB All DBs
Position
405753..407066
Genome map
AA seq 437 aa AA seqDB search
MDDQVLFAQYAARVNEWGNQVKETLALRGASTDGASSLLEFIAEHDGEWTEEAVRELQRL
ADDVYVGALRQYVMEAAAWGRQVEQALSARRMAEDVGLSSLLAYIDGHGDEWTEEAIYEL
QRLVDDVYTRAVRLADSSAAEREEEATQEQVEGESVSPELESENKENEDGWLDTSGTAER
VEDAKEPAFMAELSDSLPDIADGEPGQADNVTDGKRRWVDADDGGEPRQQVAPGRHVLPP
LPYRYDALEPHISEEIMRLHHTKHHQSYVDGLNKAERMMAEARRTNNFDLLKHWEREAAF
HGSGHYLHTIFWYNMHPEGGGEPRGELRAQIERDFGSFAAFRRHFTEAAKSAEGVGWALL
VWAPRAHRLEILQAEKHQLMAQWDVIPLLVLDVWEHAYYLQYKNDRAAYIEHWWNVVNWR
NVEERFHEARKLRWQPF
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggacgatcaggtgttgttcgcccaatatgcggctagggtgaacgaatggggaaatcaa
gtcaaggagacgctcgctttgcgtggggcaagcacggatggcgcttcgtcgctgctcgag
tttattgccgagcatgacggcgagtggacggaagaggccgtccgcgagcttcagcgcctt
gccgatgacgtgtatgtcggtgcgcttcgccagtatgtcatggaagcggctgcgtgggga
agacaagttgaacaggcgctgtctgcacgcaggatggctgaggatgttgggctttcgtct
ttgttggcgtacatcgatggacacggcgatgaatggaccgaagaagcgatttacgagctc
cagcgtcttgtcgatgacgtatacactcgggccgtccgcctggctgattcgtcagctgcc
gagcgggaagaagaggcgacgcaagaacaagtcgaaggggaatcggtgtcgcctgaactg
gagagtgaaaacaaagagaacgaagacggatggcttgacaccagcgggacggcagagcgg
gttgaggacgcaaaagagccggcttttatggcggagctctccgactcgctgcctgatata
gctgacggcgagccgggtcaagcggacaacgtgaccgatggaaagcgacgctgggtggat
gcggacgacggcggtgagccgcgtcaacaagtagcgcccggccgtcatgtcttgccgccg
ctgccgtaccgttatgatgcgctcgagccgcatatttccgaagaaatcatgcgcctccac
catacgaagcatcatcaaagctatgtcgacggcctcaacaaagcggagcggatgatggcc
gaggcgcgccggacgaacaattttgatctgttgaaacattgggagcgggaagcggcgttc
cacggctccgggcattatttgcacactatcttttggtacaacatgcatccagagggcggc
ggcgagccgcgcggggagctgcgggcgcaaatcgagcgcgattttggcagctttgccgcc
tttcgccgtcatttcaccgaagcggcgaaaagcgccgaaggggtcggctgggcgttgctc
gtttgggcgccgcgagcgcaccggctggaaattttgcaggcggaaaaacaccagctcatg
gcgcaatgggatgtgatcccgcttcttgtgcttgatgtgtgggagcatgcctactatttg
caatacaaaaatgatcgggcggcgtacatcgaacattggtggaacgtcgtcaactggcgc
aacgttgaagagcgctttcatgaggcgcggaagcttcgttggcagccgttttaa

DBGET integrated database retrieval system