KEGG   Geobacillus sp. Y412MC61: GYMC61_1259Help
Entry
GYMC61_1259       CDS       T01101                                 

Definition
(GenBank) aldehyde oxidase and xanthine dehydrogenase molybdopterin binding protein
Organism
gyc  Geobacillus sp. Y412MC61
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Motif
Other DBs
NCBI-ProteinID: ACX77909
LinkDB All DBs
Position
complement(1287132..1289459)
Genome map
AA seq 775 aa AA seqDB search
MAVGKSIIRKEAWDKVTGRAKYTNDFKEQGMLHAALVTSPYAHARILSLDARRALAAPGV
HAVVTGEGLPLTGEDMRDRPPIAVDKVRYYGEVVAVVVADTLAQAEQAARLVRVVYEPLP
AVGSPREALKKGAPLLHEHLDRYEKNKTTHPEPGTNVAHRTKIRKGNIEQGFAESDVIVE
TSVSFAPSDHIAMETRCATAEIWPDGTIHISASSQSPFMIKKLLHTYFGEETGKVIVHTP
LVGGAYGGKAPVQLELLAYLASKAVGGRKVSVWNSREHDMVTSPVHIGLEATVKIGATKD
GLFKAMEILFLFDGGAYSDKAIDVSRAAAVDCTGPYHVENVFCDSLCVYTNRPYATPFRS
FGHCEQAFAIERAIDELAQELQLDPWEVRRKNAIRPGHTTPTQVRLTKSNVGNMPSCLDR
LRELMRWDEWQRVEVDAYTVRAKGIGAGWKTSTIDTDASSGVILTFNSDGSVNVISGVVE
IGTGTKTVLAQIVAERLKMDVDRVHVKMDIDTQTTPEHWKTVASRGTFMAGRAALAAADD
AIRQLKDIAACVLRASPDDLEVGFGRVFLRDDPAVFLPIKDIAYGYKFPNGNAIGGQVIG
RGHYILRRLTPLDPKTGAGQPGPEWGVCAEGVEIEFNRRDYTYRIVKAYAVIDAGKVLNP
KAALGQAMGAMSMGLSFASREGFLFDNEQRVLNPQLRTYRPIRFGEHPEYIVEFVETPQI
DAPYGARGIGEHGLISMPAALANALSLAAGVPLNELPLVPELIWRKQKGDSYGSV
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtcggtaaaagcattatccgcaaagaagcgtgggataaagtgaccggccgtgcg
aaatatacgaacgatttcaaagaacaggggatgcttcatgctgctctggtgacaagccca
tacgcccatgcgcgcatcctctcgctggatgcacgccgcgcactcgccgcccccggcgtc
catgctgttgtgaccggtgaagggcttccgctcaccggtgaagacatgcgcgatcgtccg
ccgatcgccgtcgacaaagtgcgctactatggcgaagtcgtcgccgtcgtcgtcgccgat
acgctcgcgcaagccgaacaagcggcccgcctcgtccgcgtcgtttacgaaccgcttcca
gccgtcggctcgccgcgcgaggcgttgaaaaaaggcgctccattattgcatgaacatctc
gaccgttatgaaaaaaacaaaacgactcatcctgagccggggacaaacgtcgcccaccgg
acgaaaatccgaaaaggcaacattgaacaagggtttgcggaaagcgacgtcatcgtcgaa
acgagcgtatcgttcgccccttccgatcatatcgcgatggaaacacgctgcgccacggcg
gaaatttggccggacggcacgattcatatttccgcctcctcacagtcaccgtttatgatc
aagaaactgcttcatacgtattttggcgaagaaaccggcaaagtcatcgttcatacgccg
cttgtcggcggcgcctacggaggaaaagcgcccgtccagcttgaactgctcgcctacctt
gcctccaaagcggtcggcggccgaaaagtgagcgtctggaacagccgcgagcatgacatg
gtcacttcgcccgtccatatcggtttggaggcaaccgtcaaaatcggcgcaacaaaagat
ggcttgttcaaggccatggaaatcttatttctatttgacggcggggcttattccgacaag
gcgatcgatgtcagccgcgcggctgccgttgattgcaccggtccgtaccatgtcgaaaac
gttttttgtgattcattgtgcgtctatacgaatcgcccgtatgcgacgccgtttcgcagt
tttggccattgcgaacaggcatttgccatcgagcgggccatcgatgagctggcgcaggaa
ctgcagcttgacccatgggaagtgcggcgcaaaaacgccatccgcccaggccacacgacg
cccacgcaagtgcggctcaccaaaagcaacgtcggcaacatgccctcctgcctcgaccga
ttgcgcgagctgatgcgctgggacgaatggcagcgcgtcgaagtggatgcctatacggta
agagcgaaaggaatcggcgccggctggaaaacatcgacaatcgacaccgacgcgagctcg
ggcgtcatcttaacgttcaactccgacggcagcgtcaacgtcatctccggcgtcgtcgaa
attggaacgggcacgaaaacggtgctcgcgcaaatcgtcgccgaacggctgaagatggat
gtcgatcgtgtccatgtcaaaatggacatcgatacgcaaacgacgcccgaacattggaaa
acggtcgccagccgcgggacgtttatggccggacgcgcggcgcttgccgctgccgatgac
gccatccgtcagttaaaagacatcgccgcctgcgtcttgcgggcctcaccggacgatttg
gaagtcgggttcggacgcgtctttttgcgcgatgacccggccgtctttcttccgatcaaa
gacatcgcctacggctacaagtttccgaacggcaacgccatcggcgggcaagtgatcggg
cgcggccactacattttgcgccgcttgaccccgcttgatccgaagaccggcgccggccaa
ccgggaccggaatggggcgtatgcgccgagggagtggaaattgaattcaaccgccgcgac
tacacgtatcgcattgtcaaagcgtatgcggtcattgacgccggcaaagtgctcaaccca
aaggcagcgcttggccaggccatgggggcgatgagcatggggctgagctttgccagccgc
gaagggtttctttttgacaacgaacagcgcgtgttaaacccgcagctgcgcacataccgg
ccgattcgcttcggcgaacatccggaatacatcgttgagtttgtcgaaacaccgcaaatc
gatgccccatacggcgctcgcggcatcggcgaacacggcttgatcagcatgcccgccgcc
ttggcaaacgccttgtcgctcgctgccggcgtgccgctcaatgaactgccgcttgtgcct
gaactcatttggcggaaacagaaaggggactcctatggttccgtttga

DBGET integrated database retrieval system