KEGG   Geobacillus sp. Y412MC61: GYMC61_3011Help
Entry
GYMC61_3011       CDS       T01101                                 

Definition
(GenBank) superoxide dismutase copper/zinc binding protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
gyc  Geobacillus sp. Y412MC61
Brite
Enzymes [BR:gyc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GYMC61_3011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu AHSA1 LPAM_2 NusG_II
Motif
Other DBs
NCBI-ProteinID: ACX79571
LinkDB All DBs
Position
complement(3075558..3076082)
Genome map
AA seq 174 aa AA seqDB search
MLRKTYGVVFAAALVLSGCGQENGTSRTVEMINADGDSIGTIELTEQAEGVRLKLDLEGL
PPGEHAIHIHENGSCKPPDFQSAGGHYNPDGKKHGLLHPEGAHAGDLPNIIVKDDGTVNV
ELTAPNVTLKEGEKGSLLTKDGTSIVIHAKKDDGMTQPAGDAGGRIACGEIKSS
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcgaaaaacgtacggtgtggtgttcgctgcggcgctcgtgttgtccggctgcggc
caagagaatggaacgagccggacggtggagatgatcaatgcggacggcgattcgatcggt
acgatcgagttgactgaacaggcggaaggggtgcggctgaagcttgacctagaaggtctc
ccgccgggggagcacgccattcacatccatgaaaacggaagctgcaaaccccccgatttc
caatcggccggcggtcattacaatccggatgggaaaaagcacggccttttacacccggag
ggggcgcatgccggcgatttgccgaacattattgtgaaggatgacggcacggtcaacgtc
gagctgacggcgcccaatgtgacgctgaaagaaggagagaaaggctcgctgcttacaaaa
gacggaacatcgatcgtcattcacgccaagaaagacgacggcatgacccagccggcggga
gacgccggcggacggatcgcctgcggggaaatcaagtcgtcgtga

DBGET integrated database retrieval system