KEGG   Geobacillus sp. Y412MC61: GYMC61_3202Help
Entry
GYMC61_3202       CDS       T01101                                 

Definition
(GenBank) flagellar protein FlaG protein
  KO
K06603  flagellar protein FlaG
Organism
gyc  Geobacillus sp. Y412MC61
Brite
KEGG Orthology (KO) [BR:gyc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:gyc02035]
    GYMC61_3202
Bacterial motility proteins [BR:gyc02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    GYMC61_3202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlaG
Motif
Other DBs
NCBI-ProteinID: ACX79757
LinkDB All DBs
Position
complement(3253027..3253386)
Genome map
AA seq 119 aa AA seqDB search
MTIERVSSSFLSYEPMRSEQAKGDVELSAARPQEAEASSPLERLPSEETLEKVVNGLNEL
VQPSHTSVRFELHKELNEYYVQVIDEKTHEVIREIPPKKLLDMYAAMMEFVGLLVDKKI
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgacgattgaacgggtgtcttcttctttcctttcatatgagccgatgcgaagtgaacag
gcgaagggggacgtcgagctttcagcggcgcggccgcaggaggcagaggcgtcgtctcct
cttgagaggctgccatcagaggaaacgcttgagaaagtggtcaacggcttgaatgagctc
gtgcagccgagccatacgtcggttcggtttgagctgcacaaagagttgaacgagtattac
gtgcaagtaatcgatgaaaagacgcatgaggtgatccgcgaaattccgccgaaaaagctg
ttggatatgtacgcggcgatgatggagtttgtcgggcttttggtggataaaaaaatttaa

DBGET integrated database retrieval system