KEGG   Geobacillus sp. Y412MC61: GYMC61_3229Help
Entry
GYMC61_3229       CDS       T01101                                 

Definition
(GenBank) FlgN family protein
Organism
gyc  Geobacillus sp. Y412MC61
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlgN RNA_pol_A_CTD FliT
Motif
Other DBs
NCBI-ProteinID: ACX79783
LinkDB All DBs
Position
complement(3278486..3278956)
Genome map
AA seq 156 aa AA seqDB search
MMTFAALIHLLRAHSELYESLLALSRRKTEALKKNDIEALSALLADEQKHILAIRQLEER
RRHWLKEALGNEAATISQCVHLATGKEREELRECQARLQTAVAAVAEANELNRQLIEQSL
QFVTAMIETFAPTLSTYSRTQQYAPSPERPLFESKA
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
gtgatgacgtttgcggcactcatccatcttttgcgggcgcacagtgagctttatgaaagc
ttgctggcgctttcgcggcggaagacggaagcgttgaagaaaaacgacatcgaggcgctg
tcggctttgcttgccgatgaacagaagcatattttggccatccgccaactcgaagaacgg
cggcggcattggctgaaggaggcgctcggcaatgaggcggcgaccatttctcaatgcgtc
cacctggcgacaggcaaggagcgcgaggagctaagagaatgccaagcgcggcttcagacg
gctgtcgccgcggtggcggaagcgaatgagctgaaccgccagctcatcgaacagtcgctc
cagtttgtcaccgcgatgatcgagacgttcgccccgacgctgtccacctacagccgcacg
caacaatatgccccttcgcccgagcgcccgctgtttgaatcgaaagcgtaa

DBGET integrated database retrieval system