KEGG   Geobacillus sp. Y412MC61: GYMC61_3230Help
Entry
GYMC61_3230       CDS       T01101                                 

Definition
(GenBank) anti-sigma-28 factor, FlgM
  KO
K02398  negative regulator of flagellin synthesis FlgM
Organism
gyc  Geobacillus sp. Y412MC61
Pathway
gyc02020  Two-component system
gyc02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:gyc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GYMC61_3230
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    GYMC61_3230
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:gyc02035]
    GYMC61_3230
Bacterial motility proteins [BR:gyc02035]
 Flagellar system
  Flagellar assembly proteins
   Regulation
    GYMC61_3230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlgM
Motif
Other DBs
NCBI-ProteinID: ACX79784
LinkDB All DBs
Position
complement(3278969..3279235)
Genome map
AA seq 88 aa AA seqDB search
MKIRHIGPMGVNPYQRQLAKTERLAAEKAPRDQVEISKEAKELQEAASWEQARQAKLEEL
RQQIENGAYQVDPRAVAKRMIEYYRNHR
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccgccatattggaccgatgggcgtcaacccgtaccagcgtcagctcgccaaa
acggagcggctggcggcggagaaggcgcctagagatcaagtggaaatttcgaaagaagcg
aaagagctgcaagaagcggcaagctgggaacaggcgcggcaggcgaaacttgaagagctg
cgccaacaaattgaaaacggcgcataccaagtcgacccgcgggcggtcgccaagcggatg
atcgagtattaccgaaaccatcgataa

DBGET integrated database retrieval system