KEGG   Paenibacillus sp. Y412MC10: GYMC10_0151Help
Entry
GYMC10_0151       CDS       T01100                                 

Definition
(GenBank) phosphoribosyl-ATP diphosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
gym00340  Histidine metabolism
gym01100  Metabolic pathways
gym01110  Biosynthesis of secondary metabolites
gym01230  Biosynthesis of amino acids
Module
gym_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:gym00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    GYMC10_0151
Enzymes [BR:gym01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     GYMC10_0151
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     GYMC10_0151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: ACX62460
UniProt: D3E888
LinkDB All DBs
Position
178434..179135
Genome map
AA seq 233 aa AA seqDB search
MSEDMLKDLSLEQVSEHIRWDAAGLVPAIVQDAESKQVLMMAYMNRESLRLTLESGETWF
WSRSREELWHKGATSGNVQTVVSMSYDCDGDTLLLQVNPNGPACHTGQTTCFHNEITAQG
QDSEPASQGTAASGERFAVLAELEEVIAQREVERPEGAYTTYLFDKGVDKILKKVGEEAS
ETIIAAKNKDNAELKLEVSDLIYHLLVLLQERKLPLDEIMDELSRRHERPRRD
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaagatatgttgaaagatttatccctggagcaggtcagcgagcacatccgttgg
gatgccgcgggcctggtgccggcgattgtacaggatgcagagagcaagcaggtgctgatg
atggcttatatgaaccgggaatcgcttcgattgacgctggaaagcggcgagacttggttc
tggagccgttcgcgcgaagagctgtggcataagggggcaacttccggcaacgtccagacg
gtcgtttccatgagttacgactgtgacggagacaccctcttgctgcaggtgaatccgaat
ggacctgcctgtcataccggacaaacgacctgcttccacaatgagattaccgctcaaggg
caggatagcgagcctgcgagccaggggacggctgcgtccggcgagcgcttcgcggtactt
gccgagctggaagaggtcattgcccagcgtgaggtggaacggccggaaggggcctatacg
acctacctgttcgataaaggcgtggacaaaatccttaagaaggtgggcgaagaagcttcc
gaaacgatcattgccgccaaaaataaagacaacgccgagctgaagcttgaagtcagcgat
ctgatctatcacctactggtactccttcaggagcggaagctcccgctggatgagatcatg
gatgagctgagccgccggcatgaacggccgcgccgcgattag

DBGET integrated database retrieval system