KEGG   Paenibacillus sp. Y412MC10: GYMC10_0263Help
Entry
GYMC10_0263       CDS       T01100                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
gym00061  Fatty acid biosynthesis
gym00071  Fatty acid degradation
gym01100  Metabolic pathways
gym01212  Fatty acid metabolism
gym02024  Quorum sensing
Module
gym_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:gym00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GYMC10_0263
   00071 Fatty acid degradation
    GYMC10_0263
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GYMC10_0263
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:gym01004]
    GYMC10_0263
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gym04147]
    GYMC10_0263
Enzymes [BR:gym01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     GYMC10_0263
Lipid biosynthesis proteins [BR:gym01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   GYMC10_0263
Exosome [BR:gym04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   GYMC10_0263
  Exosomal proteins of breast cancer cells
   GYMC10_0263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACX62570
UniProt: D3E9B9
LinkDB All DBs
Position
305110..306786
Genome map
AA seq 558 aa AA seqDB search
MDTKPWLPFYPPEVAPAFDYPKQNLALFLVTSAQKFPNRPALYFMGKTINYRSLLDASYR
MANALRSKGIKKGDRVAIMLPNCPQVVISYYGVLLAGAVAVMTNPLYMEREIAHQMKDSG
AKIIITMDMFVSRVEKVIEETELEHMIVTSVADYLPFPKNLLYPIKAKKEGPLPVVDYGS
RVHAFKKLLAGAPNDPVCESVKAEKDLALLQYTGGTTGVPKGVMLTHMNLIANTVQSANW
CFQVEDGKERYLAVLPCFHVFGLTVLLNQAIYRAGMLILVPKFEVTMILNLIKKMKPTLF
PGAPTMYIALINHPKIREYDLSSINACVSGSAGLPVEVQDKFEELTKGRLIEGYGLTEAS
PVTHVNPIWGRRKIGTIGVPVPDTDAKVVDPETGEEMPVGEPGELIVKGPQVMMGYWNRP
EETFDTLRNGWLFTGDMATMDEEGYFTIIDRKKDMIIASGFNIYPREIEEVLYEHPSVKE
AVVVGTKDDYRGETVRAYIVLKDGASPDPSGLEKFCRSQLAAYKVPREYVFRDSLPKTMV
GKVLRRKLLEEEEEGKTG
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaagccttggctgccgttttatccgcccgaagtagcccccgcttttgattat
ccgaaacagaatttggcattatttctcgtaacctcggcgcagaagtttccgaatcgtccg
gccctgtatttcatgggaaagacgatcaactacagaagtctgctggatgcgtcctaccgg
atggcgaacgcgctccgcagcaaagggatcaagaagggcgaccgggtagcgatcatgctg
cccaactgcccgcaggtcgttatttcctattatggcgtgctgctcgcaggagccgtggcc
gtcatgaccaacccgctctatatggagcgggaaattgcgcatcagatgaaggattccggt
gccaagatcatcattacgatggatatgttcgtatcccgcgttgaaaaagtcatcgaggag
acggaactggagcatatgatcgtcacgtccgtggcagattatctgccgttccccaagaat
cttctctacccgatcaaagccaagaaggaaggccctcttccggtcgtcgactatggaagc
cgcgtccatgctttcaaaaagctgcttgcgggcgcgccgaatgatcccgtctgcgaatcc
gtgaaagcggagaaggatttggccctgctccagtatacaggcggcacgacaggcgttccc
aaaggcgtcatgctgacgcatatgaatctgatcgccaacaccgtgcagtccgcgaactgg
tgctttcaggtggaggacgggaaggagcggtatttagccgttctgccgtgctttcacgtg
ttcggtctcaccgtgctgctgaaccaggcgatctatcgtgccggcatgctgatattggta
ccgaaattcgaagtgacgatgatcctgaacctgatcaaaaaaatgaagccgacgctcttc
ccgggcgccccgaccatgtatatcgcattgattaatcatcccaagatcagggaatacgac
ctctcttcgatcaatgcctgcgtcagcggctctgccgggcttccggtcgaggtgcaggat
aagttcgaggagctgaccaaagggcggctgatcgaaggctacggcctgaccgaagcatcc
ccggttacccatgtgaatccgatatggggaaggcggaagatcggcaccatcggcgtcccc
gttccggatacggacgcgaaggtcgtggatccggagacgggcgaagaaatgccggtcggc
gagcctggcgagctgatcgtgaagggaccgcaggtgatgatggggtactggaaccggccg
gaggagacgtttgatacgctccgcaacggctggttgttcacgggcgacatggccacgatg
gacgaagaggggtattttacgatcatcgaccgtaagaaagacatgatcattgcaagcggt
ttcaatatttatcctcgggagatcgaggaagtgctgtatgagcatccgtccgtgaaggaa
gccgtcgtggtcggaacgaaggacgattatcgcggcgaaaccgtaagagcttatattgta
ctgaaggacggcgcgtctccggacccttcgggcctggagaaattctgccgcagccagctg
gcggcctataaagtgccgcgcgagtacgtgttccgcgattcgctgccaaagacgatggta
ggcaaggtgctacgccgcaagctgctggaggaagaagaggaaggcaaaacaggctaa

DBGET integrated database retrieval system