KEGG   Paenibacillus sp. Y412MC10: GYMC10_0669Help
Entry
GYMC10_0669       CDS       T01100                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
gym03030  DNA replication
gym03410  Base excision repair
gym03420  Nucleotide excision repair
gym03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:gym00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    GYMC10_0669
   03410 Base excision repair
    GYMC10_0669
   03420 Nucleotide excision repair
    GYMC10_0669
   03430 Mismatch repair
    GYMC10_0669
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gym03032]
    GYMC10_0669
   03400 DNA repair and recombination proteins [BR:gym03400]
    GYMC10_0669
Enzymes [BR:gym01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     GYMC10_0669
    6.5.1.6  DNA ligase (ATP or NAD+)
     GYMC10_0669
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     GYMC10_0669
DNA replication proteins [BR:gym03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    GYMC10_0669
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     GYMC10_0669
DNA repair and recombination proteins [BR:gym03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     GYMC10_0669
   NER (nucleotide excision repair)
    Other NER factors
     GYMC10_0669
   MMR (mismatch exicision repair)
    Other MMR factors
     GYMC10_0669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ACX62971
UniProt: D3ECS8
LinkDB All DBs
Position
complement(791049..791915)
Genome map
AA seq 288 aa AA seqDB search
MFIDPMLLATAPVPFSDSRFIFEPKIDGHRLIFSQQNGVVRLYTRHNNDCTHQYPEIANA
LFPHDIVLDGEIACVDSATGNPDFETVMTRFQAKKTDKIAALSVSKPVTFVIFDVLQNNG
VDLRRLPLLKRKEILSSIPLPSNNFGIIPFIEGAGEALFTQIEEREMERIVGKRKESIYE
TGRRSDNWRKIINWLYADVFIIGYRKEEFGWLAAVPTLDNAKMRPAGIIELGANPTHKKA
FYNVVKPLVTGEDRNFVYVEPRIRARVKMRNWTRSGMLRTPVFERFII
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgtttattgatccgatgttactcgcaacagcgccagttccattctcagactcgcgcttc
atatttgaacctaaaatcgatggccatcgcttgattttttcgcagcagaatggcgttgtt
cgcctatacacacgccataacaacgactgtactcaccaatatcctgagatagccaacgct
ttgtttccgcatgacatcgtattagacggcgaaatcgcgtgcgttgattccgcgaccggc
aacccggattttgaaacagtcatgacacgattccaggcgaagaagactgataagattgct
gcactttccgtttcaaaacctgtcactttcgttatctttgacgtgctgcaaaataatgga
gtggatctccggcgactgccgttgttgaagcgtaaagaaatactctcatcgataccgtta
ccgtccaacaacttcggcattattccatttatagaaggtgctggcgaagcgttgtttact
cagatagaggaacgtgagatggagcgcattgtcggtaagcggaaggaaagcatttatgag
acgggaagacgatcggacaactggcgcaaaattattaactggttgtatgccgatgtgttt
attatcggctaccggaaagaggaatttggatggctggcggccgtgccaacgcttgataac
gcaaaaatgcgcccagccggtattatcgagctaggcgcaaatcctacacataagaaggcg
ttttataacgttgtgaagccgttggttaccggtgaggatcgcaatttcgtctacgttgag
ccgcggattcgtgcccgtgtgaagatgcggaactggacgcggtcgggaatgttgcggact
cctgtgttcgagaggtttattatttaa

DBGET integrated database retrieval system