KEGG   Paenibacillus sp. Y412MC10: GYMC10_1254Help
Entry
GYMC10_1254       CDS       T01100                                 

Definition
(GenBank) TrkA-C domain protein
  KO
K07228  TrkA domain protein
Organism
gym  Paenibacillus sp. Y412MC10
Brite
KEGG Orthology (KO) [BR:gym00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    GYMC10_1254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkA_C
Motif
Other DBs
NCBI-ProteinID: ACX63541
UniProt: D3EI70
LinkDB All DBs
Position
1481505..1481993
Genome map
AA seq 162 aa AA seqDB search
MSIIRESDLPGIGKKFLIQARSGDKLVVVIHDDGRRELYHFEDDDPEETISQITLEDDEA
RQIAGIIGGMTYKPKALETIEVTLEDLIIEWARIEPHYKCVGQSIAGLQVRQRTGANVLA
IVNKKEQKINPGPDDILTAGSTLVLAGERKQIKQLKELLVNG
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagtattattcgcgaatctgatctgccgggtatcgggaagaagttccttattcaggcg
agatcaggggataagctggttgttgttattcatgacgatggccgtagagagttgtaccac
tttgaagatgacgatcctgaggagaccatctcccagattacattagaggatgacgaggca
agacaaatcgcaggcattatcggcggcatgacgtataaaccgaaagcgctggagaccatc
gaagtgacgctcgaagatttgatcatcgaatgggcgcgaatcgagccgcattacaaatgc
gtgggacaatccattgcagggcttcaggttcgtcaacgtactggcgctaatgtattagcg
attgtgaacaagaaagagcagaaaatcaatccgggtccggacgacatcctgacagcagga
tcgacgctggtgcttgcgggcgagcgcaagcagatcaagcagctgaaagaactgctggtc
aacggctaa

DBGET integrated database retrieval system