KEGG   Paenibacillus sp. Y412MC10: GYMC10_3439Help
Entry
GYMC10_3439       CDS       T01100                                 

Definition
(GenBank) integral membrane sensor hybrid histidine kinase
Organism
gym  Paenibacillus sp. Y412MC10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c Response_reg His_kinase HisKA 7TMR-DISM_7TM HATPase_c_2 HATPase_c_3 HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: ACX65677
UniProt: D3EIK3
LinkDB All DBs
Position
3977213..3980368
Genome map
AA seq 1051 aa AA seqDB search
MTTILAKNHKRFRIIALLPHFAAFVVFLSMLLGIRWLWLESYAPPADQPKVSNGILDLRG
WDLLGAKSINLDGEWQFYADILAKEQEMKPSHEFTYVNVPGDWNNNRTNKTKTSSFGIGT
YRLRILLDRPLSTPISFWIQEIQSAATVDINGETVASMGRTGEPGQASYLPNRTSFVVDY
VPDRDARELDLIIRVANYEHPYLGGIAKPIKLGSHQAIQDEHGVSVDLQLIMFVVLMLHG
LYAFILYIFNPRERSLLDFFLLLVSAALTVVTSDDSLLLKWVPLNYEWEVKVTFLSYSWL
SYFIWKLSRTFTARNRNVWFITFSTLLALYTVVVFAAPVSWVHWLVEFRVFGAFYLLPML
MSLFLFTRMVFNSQDDSIFLLLSASGVLASAVWGALNKYWELPAVYYPVDVLAAIIGFSA
YWFKRYFRNLHQISKLNDKLKLADQMKDRFLANTSHELRTPLHGIMNIAISLAEREKETL
GKQSSEDLNLLITVSRRMSHLLNDLLDAVRLQEKQIQLQLSRVSLVSVVNGVFDIVKFMT
DGAPVQLKMNIPEALPAVQADEKRLVQILLNLIHNAIKYTEKGSVTVSAFTKGSKMTILV
TDTGIGMDPQTLNRIFLPYEQGNQGLNDAKGIGLGLSISKELVELHDGELTVESESGKGT
TFAFTLPLADTNAEYSASQRVHVPAVDTAVYKELAASWDVAAGGTPMQVPTKLWSKEHPV
SILAVDDDPVNLRILAGILSAEPYNLSVVASAAEALELLGSQPWDLLIADVMMPEMSGYE
LTRTVRERFNAAELPVLLLTARGESADVYAGFQSGANDYVTKPVDPVELRYRIHSLITLK
HTVDDRLRMEAAYLQAQIHPHFLFNTLNSIMALSEMDIDRMRSLGEAFSSYLQISFHYRN
QDRLVPLQQELELIQAYLYVETERYGERLNVTWEVDWDLNVLIPPLAIQPLLENAVRHGI
MKRASGGTIRVRIAMQEDFIIVEVTDNGLGMEPDQVTQLLNAPDHRKGGIGLYNTNRRLL
QTFGSGLVIKSTMNQGTTVSFQIPAQLPSHA
NT seq 3156 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaccatactcgcaaagaaccacaaacgatttcgaatcattgcattactcccgcat
tttgcggcatttgtcgtttttttgagcatgctcctggggatccgttggctctggcttgaa
tcctatgcccctcctgcagatcaaccgaaagtctccaatggaatactcgatttgagaggc
tgggatctgttgggcgcaaaatccatcaatctggacggagagtggcaattctacgccgac
atcctggctaaagaacaagaaatgaagccgtctcatgagtttacctacgtaaatgtacct
ggagactggaataacaatcgtacgaataagacaaaaacttcgtcgtttggcatcggaacg
taccgacttcgcatattgctggatcgcccgctttcgacccctatctcgttctggatccag
gagattcaatccgcggctaccgtggacatcaacggcgaaacggtagcttccatgggaagg
acgggcgagcccggccaagcctcctatctgccgaaccgcacctctttcgttgtcgattat
gttcccgaccgggatgctcgcgagctcgatctgatcatccgcgtggcgaactatgagcat
ccttacttaggcggaatcgcaaagccgatcaagctgggatcgcaccaggcaatccaggat
gagcacggcgtttccgttgatcttcagctgattatgtttgtcgtcctgatgctgcacgga
ctgtacgccttcattctatacatattcaatccgcgggaaaggtcgctgctcgattttttc
ctgttgctagtatcggccgctttaaccgtcgtgacatcagacgacagcctcctgctgaaa
tgggtgcctttaaactatgaatgggaggtcaaagtaacctttctctcttattcgtggctg
tcgtatttcatatggaagctgagccgcacctttaccgcccggaaccgtaatgtgtggttt
atcacattcagcacgcttctggctctatatacggtcgtagtctttgccgctcctgtgtct
tgggttcactggctcgtagaattccgggtgttcggcgccttttacctgctgccgatgctg
atgtcgctgttcctgtttacccgaatggtctttaacagccaggatgattccatattcctg
ctgctgtcggccagcggcgtgctggcaagcgccgtatggggggcgcttaataaatattgg
gaactccccgccgtgtattatccggtggacgtgctcgcggccatcatcggattttcggcc
tattggtttaagcgatacttccgcaaccttcatcaaatcagcaaactcaacgataagttg
aagctcgcggatcaaatgaaggaccggttcttggccaacacgtctcacgagctgcgtacg
ccgctgcacggaatcatgaatatcgccataagccttgctgaacgggagaaagaaaccctc
ggcaaacagagcagcgaggatttgaacctgttgattacggtcagccgccggatgtcgcat
ttattaaacgacctgctggatgccgtccgtcttcaggagaagcaaattcagctgcagcta
agccgggtttccctggtttccgtcgtcaacggggtattcgatatcgtaaaatttatgacg
gacggcgcgcccgttcagctcaagatgaatatccccgaagcccttcctgccgtacaggcg
gatgaaaagaggctcgttcaaattttgctcaatctgattcacaacgccatcaaatacacg
gagaaaggctccgttaccgtctccgcctttaccaagggcagtaaaatgacgatcttggta
acggatacggggatcgggatggaccctcaaacgctaaaccgcatttttcttccgtacgag
caggggaatcaagggttgaatgacgcgaaggggatcggcctagggcttagcatcagcaag
gaactcgttgaactgcatgacggcgagctgacggtcgaatcggaatcagggaaaggaacg
acttttgcgttcacactcccgcttgcggacacaaacgcagagtactctgcttcgcagcgg
gttcacgtacccgctgtagacacagctgtctacaaagaactcgctgccagctgggacgtc
gcagctggcggtacccctatgcaggtacccacgaagctatggtcgaaagagcatcccgtc
agtatcctggccgtggatgacgatcctgtaaacctgcgcatccttgccggcattctttcg
gcagagccgtacaacctgagtgtcgttgcctcggctgccgaagcgcttgagcttctcggc
tcgcagccgtgggatctcctcatagcggatgtcatgatgccggagatgtccggctacgag
ctcacccgcaccgtaagggagcgctttaacgcagcggagctgcccgtactgctgctgacg
gctcgaggcgaatcggccgatgtgtatgcaggcttccaatccggcgcaaatgattatgta
acgaagccggttgatcctgtagaattgagataccgcatccattccctgatcacgctgaag
catacggtggatgatcgcctgcgcatggaagcagcctatttgcaggcacagatccaccct
cactttttgttcaacaccttgaattcgattatggcgcttagcgaaatggacatcgatcgc
atgcgaagccttggcgaggctttcagctcctatctgcagatcagcttccattatcggaat
caggatcggctggtaccgctgcagcaggagcttgagcttatccaagcctatttatacgta
gagacggaacgatacggggaacgcctgaacgtgacctgggaagttgattgggatctcaac
gtcctcatcccgccgctggcgatccagccattattggaaaatgcggtgcggcacggcatt
atgaagagggccagtggcggtacgatacgggtcaggattgcaatgcaagaggactttatc
atcgttgaagtgacggataacgggcttggcatggaacccgaccaggttacccagctgctg
aatgcacccgaccatcgaaaaggcggcatcggtctctacaacacgaatcgtcgtctgctc
caaacctttggcagcgggctggttatcaagagcacgatgaatcaaggcactacggtttct
tttcaaattccagcgcagcttccttcacatgcataa

DBGET integrated database retrieval system