KEGG   Paenibacillus sp. Y412MC10: GYMC10_4927Help
Entry
GYMC10_4927       CDS       T01100                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
gym00020  Citrate cycle (TCA cycle)
gym00480  Glutathione metabolism
gym01100  Metabolic pathways
gym01110  Biosynthesis of secondary metabolites
gym01120  Microbial metabolism in diverse environments
gym01130  Biosynthesis of antibiotics
gym01200  Carbon metabolism
gym01210  2-Oxocarboxylic acid metabolism
gym01230  Biosynthesis of amino acids
Module
gym_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gym_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:gym00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GYMC10_4927
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GYMC10_4927
Enzymes [BR:gym01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     GYMC10_4927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ACX67141
UniProt: D3ECL7
LinkDB All DBs
Position
complement(5584952..5586244)
Genome map
AA seq 430 aa AA seqDB search
MKLEKFALPTEGEKITIDNGTLQVPNNPVIPFIEGDGTGRDIWKASKRVLDAAVEKAYNG
SKKIAWYEVFAGEKAYNTYGEWLPNDTLEAIREYIVAIKGPLTTPIGGGIRSLNVALRQE
LDLYTCLRPVRYFNGVPSPVKRPELVDMVIFRENTEDIYAGIEYKEGSDEVKKVIKFLQD
EMGANKIRFPETSGIGIKPVSSEGSKRLVRAAVEYAIKHGRKSVTLVHKGNIMKFTEGAF
KNWGYEVAEAEFGDKVFTWAQYDIIKDKDGVDAANAAQKAAEEAGKIIVKDAIADIALQQ
VLTRPTDFDVIATLNLNGDYLSDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKYA
DKDVVNPGSVILSGVMLLEHLGWQEAADLIYKGMETSINNKTVTYDFARLMEGATEVKCS
EFADEIIKNL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaattggaaaaattcgcattgccgactgaaggcgagaaaatcacgattgataacgga
accctgcaggtgcctaacaaccctgttattccttttattgaaggcgacggcacaggccgt
gacatctggaaagcttccaagcgcgtccttgatgcagctgtagaaaaagcgtacaacggt
tccaagaaaattgcctggtatgaagtatttgccggtgagaaggcatacaatacatacggt
gagtggctcccgaacgatacgcttgaagcgattcgcgagtacatcgttgcaattaaagga
cctcttacaacgccaatcggcggcggtatccgttccctgaacgttgcccttcgccaagag
ctggatctgtatacctgcttgcgtcctgtccgttatttcaacggcgtaccgtctccggta
aaacgtcctgagctggtcgacatggttattttccgcgagaacacggaagacatctatgca
ggcatcgaatacaaagaaggctccgacgaagtgaagaaagtgatcaagttccttcaagac
gaaatgggagcaaacaaaatccgcttcccggaaacttccggtatcggcatcaaaccggtg
tcctccgaaggttccaagcgtcttgtacgcgcagcggttgaatatgcgatcaagcatggc
cgcaaatccgtaacgctcgttcacaaaggcaacatcatgaaatttacggaaggtgccttc
aaaaactggggttacgaagtggctgaagctgaattcggcgataaagtgttcacttgggcc
cagtacgatatcatcaaggacaaggacggcgtagatgcagctaacgctgctcaaaaagcg
gctgaagaagccggcaaaatcatcgttaaggatgctattgccgatatcgcgctgcagcag
gttctgactcgcccaaccgactttgacgtcattgcgacattgaacctgaacggcgactac
ctgtctgacgctctggctgcgcaagttggcggtatcggtatcgctccgggcgctaacatc
aactacgtaacaggacatgcgattttcgaagcgactcatggtacggctccgaaatatgca
gacaaggacgtagttaaccctggttccgttatcctctccggcgttatgctgcttgagcac
ctcggatggcaggaagcggctgacctgatctacaaaggcatggaaacgtccatcaacaac
aaaaccgtgacttatgacttcgcccgcctgatggaaggcgctactgaagtgaaatgctcc
gagttcgcagacgaaatcattaaaaacctgtaa

DBGET integrated database retrieval system