KEGG   Paenibacillus sp. Y412MC10: GYMC10_5264Help
Entry
GYMC10_5264       CDS       T01100                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
gym00473  D-Alanine metabolism
gym01100  Metabolic pathways
gym01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gym00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GYMC10_5264
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    GYMC10_5264
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gym01011]
    GYMC10_5264
Enzymes [BR:gym01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     GYMC10_5264
Peptidoglycan biosynthesis and degradation proteins [BR:gym01011]
 Precursor biosynthesis
  Racemase
   GYMC10_5264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Arteri_nsp7a PAAR_motif
Motif
Other DBs
NCBI-ProteinID: ACX67474
UniProt: D3EFV3
LinkDB All DBs
Position
complement(5939256..5940443)
Genome map
AA seq 395 aa AA seqDB search
MQAIYRPTLAEINLDHLRANYNAFREALPDHMKLLACVKANAYGHGAVEVARELQQLGAA
YLSVAFLDEAIELRQGGISVPILVLGYTPPEAVGIAYEYDVTITLFSSEVLQAIKALPVK
PEKPLKVHIKIDSGMGRLGLLPGEDAISFIEEAFSLPQVVVEGMFTHFARADEENKDYTL
GQYRRFQGVADALRDKDYHIPIIHTGNSAAAIDTPELSYNMVRVGIGLYGLYPSDEVNRK
TVSLRPVMTLKTKLVYVKNLPPHSGISYGTKYVTEQEERIGTLPIGYADGFSRMLSGKAE
VLIRGRRVPVVGNICMDQCMVSLKSFAEEAEQIKAGEEVVLIGQQSGECITADELAAKLG
TIHYEVVCMIAHRVPRLYIRDDIPVKTVNALWNNL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagcgatatatcgacctaccctggcggaaatcaacctggaccatctgcgcgccaac
tataacgcttttcgtgaggcgctgccggatcacatgaaattgcttgcttgtgtgaaggcg
aacgcctatggtcacggagccgtagaagtggcacgcgaacttcagcaactgggtgcggca
tacttaagcgtggctttccttgatgaagcgattgaacttcggcaaggcggcatctctgtc
ccgatcctggtgctcggttataccccaccggaggctgtagggatcgcttacgagtatgat
gtaaccataaccctgttcagttcggaagtgctccaagcgataaaggcactgccggtcaag
ccggagaagccgcttaaggtacacatcaagattgacagcggaatgggtcgtttgggcctg
cttcccggcgaagatgcgatttcttttatagaagaagcgttttcgctgcctcaggttgtg
gtcgaaggaatgtttacccattttgcaagagcggatgaagagaacaaagactatacgttg
ggacagtatcgccgtttccagggcgttgcggacgctcttcgggataaggattaccatatc
ccgatcatacatacgggcaacagcgctgctgcgatcgatacacctgaactatcctataat
atggttcgtgtcggcatcggcttgtacggactatatccttcggacgaggtgaatcgaaag
acagtgagcctccgccctgtcatgacgctaaagacaaagcttgtctacgtcaaaaattta
cctccgcattccggcatcagctatgggacgaagtatgtaacggagcaggaagaacgaatt
ggaacccttcccatcggttatgccgatggcttctctcgtatgctgagcggtaaagcggaa
gtgctgatacgcggccgccgcgtccctgtagtcggaaatatctgtatggaccaatgtatg
gtatcgctcaaatctttcgccgaggaggcggaacaaatcaaagctggtgaagaggttgta
ctcatcggccagcaatctggcgaatgcattacggcagatgagctggcagccaagctgggg
acgatccactatgaggtcgtctgcatgattgcccaccgggtaccgcgcctatatatacgc
gatgatataccggtaaagaccgtaaacgcgctctggaacaacctttaa

DBGET integrated database retrieval system