KEGG   Paenibacillus sp. Y412MC10: GYMC10_5356Help
Entry
GYMC10_5356       CDS       T01100                                 

Definition
(GenBank) YhgE/Pip N-terminal domain protein
  KO
K01421  putative membrane protein
Organism
gym  Paenibacillus sp. Y412MC10
Brite
KEGG Orthology (KO) [BR:gym00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    GYMC10_5356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_3 DUF3533 ABC2_membrane KASH_CCD Spc7 Laminin_I PDR_CDR AIP3 Myosin_tail_1
Motif
Other DBs
NCBI-ProteinID: ACX67565
UniProt: D3EH92
LinkDB All DBs
Position
complement(6027796..6030063)
Genome map
AA seq 755 aa AA seqDB search
MKSLSVFAKDLGAAVRNKKILIPIIAVLFIPVMYSGMFLGAFWDPYGKMEDLPVAVVNND
QGAVFEGKTLHAGEDLVAELKKGKDFNWQFVNRSEAEQGMQDNKYYMTISIPENFSQQAT
TLMDEHPQPAQIVFEPNEGYNFLAAQIGGSAVKQIQSKVSAKVTEAYTETLFDQVAKVSD
GLSEAGDGATKLSEGAVKLDDGAVKLKENLAKLVSGTQELQDGIAPLTQGVQELNNGAGK
LNTGAGSLASGLDQLKAAHSQLQAGAEEAAKGGAKLQAGIESAAAGSTALNEGLQANQAG
AAQLAAGAKSAHDGSGSLKAGLNQSLEATAALEQGAKAVADGLKQLAEGNPELMQSPEVQ
KLLAASQSVASGTNELNAGQKQLAQGAAELNQGTQQLQEGAGKLSAGANQLADGGKQLAA
GGQELLAGAKQLNAGQNQLADGMKLFGTKLSEAAAGGKELASGAAALSQGTQQLAGGAGK
LGSGVTTLADGSKQLDSGAGELVNGMNELKEGSGELAGKLNEAADKTGGIQTTDETVTMF
AGPVQVDEHKVNEVPNYGTGFAPYFLSLGLFVGALLCTIILPIREASVPNASGWNRFVSR
TLSFAGMGLIQALLASVVMLYGLKLEVQSVPLFYLFSIITSLSFMFLVQMFVTWLDQPGR
FVVIVILILQLTTSAGTFPVELIPNWMKALNPLLPMTYSVKGYKDVISTGSFDGMWANVG
VLAGFGLVFLVLTAVYFLAIRNNKQAADADTAVTA
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcattatctgtgtttgccaaagatcttggtgccgccgttcggaataaaaaaata
ttgattccgatcatcgcggtgctgttcataccggtcatgtacagcggtatgttcctcggg
gccttctgggacccgtacggaaagatggaggatttgcccgtagcggtcgtcaataacgac
cagggcgctgtttttgaaggaaagacgcttcacgccggcgaggatttggtggccgagctg
aagaagggaaaagattttaattggcagttcgttaaccggagtgaagctgaacagggcatg
caggataacaaatactacatgaccatcagcattccggaaaatttctcgcagcaggcgaca
acgttaatggatgaacatccgcagcctgcgcaaatcgtcttcgagccgaacgaaggctac
aactttcttgcggcacagatcggcggatctgccgtgaagcagattcagtccaaggtgtcg
gcgaaagtgacggaagcctacacggaaaccctgttcgaccaagtggccaaagtatctgac
ggcctaagcgaagcgggggacggcgccacgaagctgtccgaaggtgccgtgaagctggac
gacggcgcagtgaagctcaaagagaacctggctaaactcgtcagcggcacgcaggagctg
caagacggcatcgcgccattgacgcagggcgtgcaggagctgaataacggtgccggcaag
ctgaacacgggagcgggctccctcgcctccggcctggatcagcttaaggcggctcacagc
cagctgcaagcaggggcagaagaggccgccaagggcggtgccaagctgcaggcgggcatt
gaatctgctgcagccggcagcacggccttgaatgaaggcctgcaagccaaccaggcaggg
gcagcccagcttgccgctggcgcgaagagcgctcatgatggcagcggcagcctgaaggcc
ggcctgaatcaatcgctggaagccacggctgcgctggagcaaggcgcaaaggccgttgcg
gacggcctgaagcagctggccgaaggcaatccggagctgatgcaaagtccggaggttcag
aagctgctggccgcgagccagtccgtcgcctccggcacgaatgagctgaatgccggtcag
aagcagctggcgcaaggcgcagcggagctgaaccaaggcacgcagcagctgcaggaaggc
gcaggcaagctgagcgccggcgcgaaccagctcgctgacggcggcaaacagctcgccgcg
ggcggccaagagctgctggccggcgccaaacagctgaacgccggccaaaaccaattggcc
gacggcatgaagctgttcggcacgaagctgagcgaagcggcagccggcggcaaggagctt
gccagcggcgcggccgccctgtcgcagggcacgcagcagctggcaggcggagccggcaag
ctgggaagcggcgtaacgaccctcgccgacggctcgaaacagctggattccggggctggc
gagctggtcaacggaatgaacgaattgaaggaaggcagcggggagcttgcaggcaagctg
aacgaggctgccgacaagactggcggtatccaaaccaccgacgaaacggtcacgatgttt
gccggaccggttcaggtagatgagcataaagtgaacgaagtaccgaactacggtaccgga
ttcgcgccatacttcctgtcgctcggcttgtttgtcggagccctgctctgcacgattatt
ctgccgatccgcgaggcatcggtaccgaacgcatcgggctggaaccggtttgtcagccgt
acgctgtcctttgccggcatgggattgattcaagcgctgctggcttcggttgtcatgttg
tacggattgaagctagaggttcagagcgttccgctcttctatctcttctccatcattacc
agcttgtcgttcatgttcctggtgcaaatgttcgtcacatggctggatcagcctggacgc
ttcgtcgtcatcgtaatcctgatccttcaattgacaacgagcgcgggcacgttcccggta
gagctgattccgaactggatgaaggctttgaatccgctgctgccgatgacctacagcgta
aaaggctacaaagacgtcatttccacgggaagcttcgacggcatgtgggccaacgtgggc
gtactggccggattcggcctggtgttcctagtgttgaccgcggtgtacttcctggcaatc
cgaaacaacaagcaagcagcagacgccgatacagcggtgactgcgtaa

DBGET integrated database retrieval system